StarFunc result for job id Q8TF46

User Input

>input (1054 residues)
MLQKREKVLLLRTFQGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVI
PDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANE
FQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGV
FVITFKNYLDNFWPDLKAAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKS
GRYIQGILNVNKHRAQIEAFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDVVVVELLP
KNEWKGRTVALCENDCDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGK
NAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDL
EGEIATILVENSISVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDLRKSHLVFSIDPK
GCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLP
SVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGN
LSVVDDIPEFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQL
DDKKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSEL
RECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEE
EFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHI
NNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGA
AYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQAS
RCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEVTKSVEEAQLAQEVKVNIIQE
EYQEYRQTKGRSLYTLLEEIRDLALLDVSNNYGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF46	1.000	1.000	0.000	1054	1.000	1.000	Q8TF46.pdb.gz	DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=2
2	AFDB:Q9Y2L1	0.751	0.822	8.911E-93	958	0.325	0.358	Q9Y2L1.pdb.gz	RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2
3	AFDB:P37202	0.761	0.823	1.882E-91	970	0.306	0.332	P37202.pdb.gz	DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis3 PE=1 SV=1
4	AFDB:Q9BI20	0.733	0.782	1.035E-88	983	0.318	0.341	Q9BI20.pdb.gz	Q9BI20_DROME Putative exoribonuclease DIS3 OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
5	AFDB:Q08162	0.752	0.789	5.870E-88	1001	0.314	0.331	Q08162.pdb.gz	RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIS3 PE=1 SV=1
6	PDB:4ifdJ	0.716	0.789	4.836E-83	948	0.311	0.346	4ifdJ.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
7	AFDB:Q384R7	0.694	0.746	8.511E-83	972	0.286	0.310	Q384R7.pdb.gz	Q384R7_TRYB2 Exosome complex exonuclease RRP44p homologue OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5380 PE=3 SV=1
8	PDB:5c0wJ	0.600	0.650	3.151E-79	970	0.308	0.335	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
9	PDB:6h25J	0.560	0.673	5.114E-78	868	0.306	0.371	6h25J.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
10	PDB:5g06J	0.591	0.626	9.431E-75	993	0.307	0.326	5g06J.pdb.gz
11	AFDB:Q8IDB6	0.718	0.706	7.798E-72	1073	0.254	0.250	Q8IDB6.pdb.gz	Q8IDB6_PLAF7 Exosome complex exonuclease RRP44 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1359300 PE=3 SV=2
12	AFDB:O14040	0.621	0.702	3.411E-66	927	0.224	0.255	O14040.pdb.gz	DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis32 PE=1 SV=1
13	AFDB:E7F350	0.605	0.639	4.039E-65	995	0.213	0.225	E7F350.pdb.gz	E7F350_DANRE DIS3-like exonuclease 2 OS=Danio rerio OX=7955 GN=dis3l2 PE=1 SV=1
14	AFDB:Q8CI75	0.603	0.723	4.304E-64	870	0.228	0.276	Q8CI75.pdb.gz	DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus OX=10090 GN=Dis3l2 PE=1 SV=1
15	PDB:2ix1A	0.454	0.700	6.552E-37	643	0.135	0.221	2ix1A.pdb.gz	Unravelling the Dynamics of RNA Degradation by Ribonuclease II and its RNA-Bound Complex
16	PDB:6f3hB	0.335	0.437	2.268E-19	790	0.085	0.114	6f3hB.pdb.gz	Structural analysis of mtEXO mitochondrial RNA degradosome reveals tight coupling of nuclease and helicase components.
17	PDB:6f4aA	0.227	0.360	2.308E-8	644	0.060	0.098	6f4aA.pdb.gz	Structural analysis of mtEXO mitochondrial RNA degradosome reveals tight coupling of nuclease and helicase components.
18	PDB:6wvdA	0.058	0.114	6.290E-3	397	0.051	0.136	6wvdA.pdb.gz
19	PDB:4c3hG	0.051	0.161	2.000E-2	259	0.015	0.062	4c3hG.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
20	PDB:7wb4j	0.068	0.070	4.177E-2	995	0.065	0.069	7wb4j.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TF46	0.0	2199	1054	1.000	1.000	DI3L1_HUMAN DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=2
2	Q9Y2L1	0.0	564	958	0.344	0.379	RRP44_HUMAN Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2
3	Q960A7	1.31e-168	523	982	0.326	0.350	Q960A7_DROME SD10981p OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
4	Q9VC93	4.09e-168	521	982	0.325	0.349	Q9VC93_DROME Dis3, isoform A OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=1 SV=1
5	Q9BI20	2.75e-161	504	983	0.323	0.346	Q9BI20_DROME Putative exoribonuclease DIS3 OS=Drosophila melanogaster OX=7227 GN=Dis3 PE=2 SV=1
6	G3V1J5	4.42e-158	489	796	0.294	0.389	G3V1J5_HUMAN DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=1
7	P37202	3.83e-156	490	970	0.315	0.342	DIS3_SCHPO Exosome complex exonuclease dis3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis3 PE=1 SV=1
8	Q08162	7.75e-145	461	1001	0.313	0.330	RRP44_YEAST Exosome complex exonuclease DIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIS3 PE=1 SV=1
9	Q384R7	8.31e-137	439	972	0.279	0.302	Q384R7_TRYB2 Exosome complex exonuclease RRP44p homologue OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5380 PE=3 SV=1
10	Q95Z12	5.16e-136	437	972	0.279	0.302	Q95Z12_9TRYP Rrp44p homologue OS=Trypanosoma brucei OX=5691 GN=RRP44 PE=1 SV=1
11	E7F350	1.11e-94	325	995	0.212	0.224	E7F350_DANRE DIS3-like exonuclease 2 OS=Danio rerio OX=7955 GN=dis3l2 PE=1 SV=1
12	Q8IDB6	2.00e-87	306	1073	0.199	0.196	Q8IDB6_PLAF7 Exosome complex exonuclease RRP44 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1359300 PE=3 SV=2
13	Q09568	7.32e-87	300	848	0.207	0.257	DI3L2_CAEEL DIS3-like exonuclease 2 OS=Caenorhabditis elegans OX=6239 GN=disl-2 PE=1 SV=2
14	O14040	3.73e-86	300	927	0.213	0.243	DI3L2_SCHPO DIS3-like exonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis32 PE=1 SV=1
15	Q8CI75	2.10e-85	297	870	0.184	0.223	DI3L2_MOUSE DIS3-like exonuclease 2 OS=Mus musculus OX=10090 GN=Dis3l2 PE=1 SV=1
16	Q8IYB7	6.32e-84	293	885	0.182	0.217	DI3L2_HUMAN DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2 PE=1 SV=4
17	P0DM58	7.14e-74	267	1055	0.168	0.168	DI3L2_ARATH DIS3-like exonuclease 2 OS=Arabidopsis thaliana OX=3702 GN=SOV PE=1 SV=1
18	Q384J0	8.22e-71	256	895	0.206	0.242	Q384J0_TRYB2 Exosome complex exonuclease RRP44, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0260 PE=3 SV=1
19	Q95Z08	1.96e-69	252	895	0.206	0.242	Q95Z08_9TRYP Putative ribonuclease II-like protein OS=Trypanosoma brucei OX=5691 PE=3 SV=1
20	E9PI20	2.58e-68	225	103	0.098	1.000	E9PI20_HUMAN DIS3 like exosome 3'-5' exoribonuclease (Fragment) OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17876 CSD2	0.0023	29.4	Cold shock domain
2	PF17849 OB_Dis3	2.8e-17	73.8	Dis3-like cold-shock domain 2 (CSD2)
3	PF00773 RNB	1.7e-83	292.2	RNB domain
4	PF17216 Rrp44_CSD1	0.0046	28.2	Rrp44-like cold shock domain
5	PF17215 Rrp44_S1	0.0037	28.5	S1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321711

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221233	0.999	Exosome complex component RRP46
2	9606.ENSP00000265564	0.999	Exosome complex component RRP42
3	9606.ENSP00000315476	0.999	Exosome complex component RRP41
4	9606.ENSP00000323046	0.999	Exosome complex component RRP40
5	9606.ENSP00000359939	0.999	Exosome complex component CSL4
6	9606.ENSP00000361433	0.999	Exosome complex component RRP4
7	9606.ENSP00000366135	0.999	Exosome component 10
8	9606.ENSP00000368984	0.999	Exosome complex component RRP45
9	9606.ENSP00000374354	0.999	Exosome complex component RRP43
10	9606.ENSP00000398597	0.999	Exosome complex component MTR3
11	9606.ENSP00000230640	0.997	Superkiller viralicidic activity 2-like 2
12	9606.ENSP00000348107	0.988	Nuclear nucleic acid-binding protein C1D
13	9606.ENSP00000352678	0.979	ATP-dependent RNA helicase SUPV3L1, mitochondrial
14	9606.ENSP00000356811	0.975	HBS1-like protein
15	9606.ENSP00000368017	0.953	Zinc finger C3H1 domain-containing protein
16	9606.ENSP00000400646	0.945	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
17	9606.ENSP00000366997	0.915	Exosome complex exonuclease RRP44
18	9606.ENSP00000258169	0.909	M-phase phosphoprotein 6
19	9606.ENSP00000264951	0.849	5'-3' exoribonuclease 1
20	9606.ENSP00000364543	0.834	Helicase SKI2W

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0000175	1.000	3'-5'-RNA exonuclease activity
GO:1901363	0.799	heterocyclic compound binding
GO:0097159	0.799	organic cyclic compound binding
GO:0003676	0.785	nucleic acid binding
GO:0003723	0.744	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044248	0.996	cellular catabolic process
GO:1901575	0.995	organic substance catabolic process
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0016070	0.995	RNA metabolic process
GO:0009057	0.993	macromolecule catabolic process
GO:0010467	0.986	gene expression
GO:0006401	0.981	RNA catabolic process
GO:0006396	0.971	RNA processing
GO:0016072	0.937	rRNA metabolic process
GO:0034661	0.882	ncRNA catabolic process
GO:0016075	0.832	rRNA catabolic process
GO:0050789	0.747	regulation of biological process
GO:0019222	0.511	regulation of metabolic process
GO:0060255	0.465	regulation of macromolecule metabolic process
GO:0050794	0.462	regulation of cellular process
GO:0010468	0.400	regulation of gene expression
GO:0071840	0.347	cellular component organization or biogenesis
GO:0048519	0.337	negative regulation of biological process
GO:0010605	0.321	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:1902494	0.990	catalytic complex
GO:0016020	0.986	membrane
GO:0031981	0.971	nuclear lumen
GO:1905354	0.938	exoribonuclease complex
GO:0000178	0.923	exosome (RNase complex)
GO:0005654	0.883	nucleoplasm
GO:0005886	0.849	plasma membrane
GO:0015630	0.747	microtubule cytoskeleton
GO:0005815	0.725	microtubule organizing center
GO:0005813	0.702	centrosome
GO:0000177	0.508	cytoplasmic exosome (RNase complex)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.-	1.000	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]