StarFunc result for job id Q8TF62

User Input

>input (1192 residues)
MFCSEKKLREVERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYF
LCLLILQLIPEISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINS
KLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALS
VTSELGADISRLAGFDGIVVCEVPNNKLDKFMGILSWKDSKHSLNNEKIILRGCILRNTS
WCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLICLGIILAIGNSIWES
QTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWD
RKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDD
LDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSE
ENSAGELIYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNT
RKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAY
RDLDDKYFKEWHKMLEDANAATEERDERIAGLYEEIERDLMLLGATAVEDKLQEGVIETV
TSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFVIAGNNAVEVREELRKAKQNL
FGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESDVKNDLLELAC
MCKTVICCRVTPLQKAQVVELVKKYRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQA
VLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQT
VYDQWFITLFNIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVL
HGIYTSLVLFFIPYGAFYNVAGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFI
NHVFIWGSIAIYFSILFTMHSNGIFGIFPNQFPFVGNARHSLTQKCIWLVILLTTVASVM
PVVAFRFLKVDLYPTLSDQIRRWQKAQKKARPPSSRRPRTRRSSSRRSGYAFAHQEGYGE
LITSGKNMRAKNPPPTSGLEKTHYNSTSWIENLCKKTTDTVSSFSQDKTVKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7py4A	0.864	0.924	0.000	1112	0.529	0.567	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
2	AFDB:A3FIN4	0.929	0.936	0.000	1183	0.542	0.546	A3FIN4.pdb.gz	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
3	AFDB:D4AA47	0.876	0.836	0.000	1251	0.539	0.514	D4AA47.pdb.gz	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
4	AFDB:P98198	0.946	0.932	0.000	1209	0.704	0.694	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
5	AFDB:Q7YXV5	0.920	0.865	0.000	1270	0.534	0.501	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
6	AFDB:Q8TF62	1.000	1.000	0.000	1192	1.000	1.000	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
7	AFDB:Q9VGD4	0.910	0.632	0.000	1726	0.539	0.372	Q9VGD4.pdb.gz	Q9VGD4_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=2
8	AFDB:Q6UQ17	0.870	0.778	5.029E-102	1335	0.435	0.389	Q6UQ17.pdb.gz	AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus OX=10090 GN=Atp8b3 PE=1 SV=1
9	PDB:7vghB	0.882	0.888	7.888E-102	1183	0.536	0.540	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
10	AFDB:P70704	0.862	0.882	8.351E-99	1164	0.387	0.396	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
11	AFDB:Q9NTI2	0.871	0.874	2.939E-97	1188	0.388	0.389	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
12	AFDB:Q9XIE6	0.825	0.812	2.948E-95	1213	0.375	0.369	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
13	PDB:6rohA	0.827	0.883	2.301E-85	1112	0.364	0.390	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
14	PDB:7kycA	0.848	0.858	8.123E-82	1178	0.355	0.359	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:7kyaA	0.857	0.870	2.335E-75	1174	0.356	0.361	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:6k7lA	0.779	0.931	2.774E-72	992	0.363	0.436	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
17	PDB:7bspA	0.635	0.721	1.765E-66	1028	0.306	0.355	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.771	0.859	2.695E-63	1064	0.310	0.347	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.733	0.933	6.534E-59	929	0.238	0.306	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.565	0.797	8.917E-47	816	0.233	0.341	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K669	827	1496	0.339	0.270	A0A0B4K669_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
2	A0A0B4LH22	828	1317	0.339	0.307	A0A0B4LH22_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
3	A0A1D8PJN3	676	1479	0.327	0.264	A0A1D8PJN3_CANAL Phospholipid-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DNF1 PE=3 SV=1
4	A0A5K1VW70	1758	1190	0.705	0.706	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
5	A0A8I5ZKC1	741	985	0.340	0.411	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A0A8I5ZXX6	860	1164	0.387	0.396	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
7	A0A8I6AVY6	862	1164	0.387	0.396	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
8	A0A8I6G2I8	741	978	0.338	0.412	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
9	A3FIN4	1377	1183	0.547	0.551	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
10	C7EXK4	860	1148	0.395	0.410	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
11	D4A3X6	862	1169	0.391	0.399	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
12	D4AA47	1266	1251	0.550	0.524	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
13	E9PEJ6	651	1191	0.340	0.340	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
14	F1LUT4	743	984	0.340	0.412	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
15	F4IE35	789	1185	0.379	0.381	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
16	F4K8T6	598	1139	0.300	0.314	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
17	H0Y547	573	935	0.284	0.363	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
18	O36028	637	1367	0.320	0.279	ATCZ_SCHPO Phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.16c PE=3 SV=1
19	O43520	1272	1251	0.543	0.517	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
20	O94296	761	1258	0.367	0.348	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	4.1e-07	41.3	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	0.017	26.2	E1-E2 ATPase
3	PF00702 Hydrolase	1.9e-05	36.6	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	2.4	19.4	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	2.9e-84	294.3	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	2.2e-26	102.7	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.894	Cell cycle control protein 50A
2	9606.ENSP00000450842	0.855	Cell cycle control protein 50B
3	9606.ENSP00000419663	0.792	Cell cycle control protein 50C
4	9606.ENSP00000267842	0.606	Very long-chain acyl-CoA synthetase
5	9606.ENSP00000366326	0.604	Nebulette
6	9606.ENSP00000241051	0.597	DEP domain containing 7
7	9606.ENSP00000351147	0.525	DDB1- and CUL4-associated factor 4
8	9606.ENSP00000331012	0.503	Uncharacterized protein C10orf120

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140326	1.000	ATPase-coupled intramembrane lipid transporter activity
GO:0140327	0.987	flippase activity
GO:0005548	0.980	phospholipid transporter activity
GO:0140333	0.892	glycerophospholipid flippase activity
GO:0008525	0.844	phosphatidylcholine transporter activity
GO:0140345	0.467	phosphatidylcholine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0006810	0.985	transport
GO:0010876	0.964	lipid localization
GO:0015748	0.951	organophosphate ester transport
GO:0006869	0.949	lipid transport
GO:0065007	0.932	biological regulation
GO:0015914	0.845	phospholipid transport
GO:0071704	0.629	organic substance metabolic process
GO:0044238	0.540	primary metabolic process
GO:0071840	0.480	cellular component organization or biogenesis
GO:0016043	0.401	cellular component organization
GO:0050789	0.358	regulation of biological process
GO:0050794	0.348	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005886	0.986	plasma membrane
GO:0032991	0.942	protein-containing complex
GO:0031090	0.888	organelle membrane
GO:0097708	0.888	intracellular vesicle
GO:0031410	0.866	cytoplasmic vesicle
GO:1990351	0.817	transporter complex
GO:1990531	0.762	phospholipid-translocating ATPase complex
GO:0098588	0.671	bounding membrane of organelle
GO:0005794	0.649	Golgi apparatus
GO:0099503	0.617	secretory vesicle
GO:0043233	0.587	organelle lumen
GO:0070013	0.579	intracellular organelle lumen
GO:0005783	0.559	endoplasmic reticulum
GO:0030659	0.452	cytoplasmic vesicle membrane
GO:0031981	0.389	nuclear lumen
GO:0042581	0.386	specific granule
GO:0035579	0.382	specific granule membrane
GO:0005829	0.368	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]