StarFunc result for job id Q8TF63

User Input

>input (244 residues)
MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPL
QGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKT
GQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKS
SDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAA
HVPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF63	1.000	1.000	2.862E-37	244	1.000	1.000	Q8TF63.pdb.gz	DCNP1_HUMAN Dendritic cell nuclear protein 1 OS=Homo sapiens OX=9606 GN=DCANP1 PE=1 SV=1
2	AFDB:Q38EJ9	0.099	0.055	1.455	504	0.168	0.081	Q38EJ9.pdb.gz	Q38EJ9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5490 PE=4 SV=1
3	AFDB:P60410	0.089	0.085	4.119	259	0.148	0.139	P60410.pdb.gz	KR108_HUMAN Keratin-associated protein 10-8 OS=Homo sapiens OX=9606 GN=KRTAP10-8 PE=1 SV=2
4	AFDB:A0A1D8PL89	0.114	0.053	6.246	629	0.201	0.078	A0A1D8PL89.pdb.gz	A0A1D8PL89_CANAL Zcf21p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF21 PE=4 SV=1
5	AFDB:Q09146	0.097	0.064	6.695	399	0.184	0.113	Q09146.pdb.gz	HBA1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hba1 PE=1 SV=1
6	AFDB:Q9V7H4	0.082	0.019	6.695	1567	0.168	0.026	Q9V7H4.pdb.gz	TM131_DROME Transmembrane protein 131 homolog OS=Drosophila melanogaster OX=7227 GN=CG8370 PE=1 SV=2
7	AFDB:Q09633	0.119	0.066	7.176	507	0.172	0.083	Q09633.pdb.gz	Q09633_CAEEL RNase H type-1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnh-1.1 PE=4 SV=3
8	AFDB:Q0J9J6	0.099	0.046	7.176	650	0.164	0.062	Q0J9J6.pdb.gz	EME1_ORYSJ Crossover junction endonuclease EME1 OS=Oryza sativa subsp. japonica OX=39947 GN=EME1 PE=2 SV=1
9	AFDB:Q6L8H2	0.080	0.080	7.692	238	0.152	0.155	Q6L8H2.pdb.gz	KRA53_HUMAN Keratin-associated protein 5-3 OS=Homo sapiens OX=9606 GN=KRTAP5-3 PE=1 SV=1
10	AFDB:Q8IWC1	0.122	0.044	9.472	876	0.172	0.048	Q8IWC1.pdb.gz	MA7D3_HUMAN MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TF63	1.04e-178	492	244	1.000	1.000	DCNP1_HUMAN Dendritic cell nuclear protein 1 OS=Homo sapiens OX=9606 GN=DCANP1 PE=1 SV=1
2	P52333	5.2	30.8	1124	0.172	0.037	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
3	A2QAN3	9.4	30.0	1007	0.086	0.021	BGALA_ASPNC Beta-galactosidase A OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250092	0.764	Macrosialin
2	9606.ENSP00000440509	0.527	TRAF-interacting protein with FHA domain-containing protein B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0032502	0.983	developmental process
GO:0001501	0.973	skeletal system development
GO:0090102	0.971	cochlea development
GO:0007610	0.968	behavior
GO:0003008	0.966	system process
GO:0009887	0.965	animal organ morphogenesis
GO:0044057	0.957	regulation of system process
GO:0009798	0.957	axis specification
GO:0007586	0.956	digestion
GO:0006939	0.955	smooth muscle contraction
GO:0009952	0.955	anterior/posterior pattern specification
GO:0048705	0.955	skeletal system morphogenesis
GO:0050877	0.954	nervous system process
GO:0009790	0.946	embryo development
GO:0065008	0.940	regulation of biological quality
GO:0007399	0.938	nervous system development
GO:0022600	0.935	digestive system process
GO:0048519	0.931	negative regulation of biological process
GO:0050885	0.928	neuromuscular process controlling balance
GO:0044058	0.928	regulation of digestive system process
GO:0009948	0.928	anterior/posterior axis specification
GO:0007350	0.928	blastoderm segmentation
GO:0060349	0.928	bone morphogenesis
GO:0090596	0.927	sensory organ morphogenesis
GO:0008595	0.908	anterior/posterior axis specification, embryo
GO:0048562	0.899	embryonic organ morphogenesis
GO:0042471	0.889	ear morphogenesis
GO:0022414	0.887	reproductive process
GO:0048646	0.872	anatomical structure formation involved in morphogenesis
GO:0050896	0.834	response to stimulus
GO:0009605	0.798	response to external stimulus
GO:0021602	0.768	cranial nerve morphogenesis
GO:0042472	0.768	inner ear morphogenesis
GO:0009612	0.766	response to mechanical stimulus
GO:0010996	0.733	response to auditory stimulus
GO:0021603	0.733	cranial nerve formation
GO:0048634	0.732	regulation of muscle organ development
GO:0035112	0.724	genitalia morphogenesis
GO:0007638	0.721	mechanosensory behavior
GO:0050878	0.720	regulation of body fluid levels
GO:0050890	0.702	cognition
GO:0051241	0.685	negative regulation of multicellular organismal process
GO:0051049	0.677	regulation of transport
GO:0090257	0.598	regulation of muscle system process
GO:0050794	0.593	regulation of cellular process
GO:1904888	0.584	cranial skeletal system development
GO:0007611	0.569	learning or memory
GO:0051051	0.555	negative regulation of transport
GO:0051046	0.524	regulation of secretion
GO:1905748	0.487	hard palate morphogenesis
GO:0071626	0.487	mastication
GO:0030432	0.487	peristalsis
GO:1901078	0.487	negative regulation of relaxation of muscle
GO:0098583	0.487	learned vocalization behavior
GO:0031223	0.487	auditory behavior
GO:0021559	0.487	trigeminal nerve development
GO:0097094	0.487	craniofacial suture morphogenesis
GO:0021650	0.487	vestibulocochlear nerve formation
GO:1905747	0.487	negative regulation of saliva secretion
GO:0007356	0.487	thorax and anterior abdomen determination
GO:0090103	0.487	cochlea morphogenesis
GO:0009987	0.484	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.997	nuclear body
GO:0005737	0.779	cytoplasm
GO:0012505	0.478	endomembrane system
GO:0071944	0.456	cell periphery
GO:0005886	0.449	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]