StarFunc result for job id Q8TF68

User Input

>input (577 residues)
MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVS
LPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPG
LVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGG
GGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSK
SEMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNFCEKSFRQLSHLQ
QHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHL
QQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEV
HLSTHTVKHAKVYTCTICSRAYTSETYLMKHMRKHNPPDLQQQVQAAAAAAAVAQAQAQA
QAQAQAQAQAQAQAQASQASQQQQQQQQQQQQQQQQPPPHFQSPGAAPQGGGGGDSNPNP
PPQCSFDLTPYKTAEHHKDICLTVTTSTIQVEHLASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EQJ4	0.487	0.486	9.012E-84	579	0.967	0.964	Q9EQJ4.pdb.gz	ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus OX=10116 GN=Znf384 PE=1 SV=1
2	AFDB:Q16587	0.302	0.275	3.970E-26	644	0.227	0.203	Q16587.pdb.gz	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
3	AFDB:Q9H5H4	0.310	0.328	7.035E-26	540	0.222	0.237	Q9H5H4.pdb.gz	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
4	AFDB:Q96MU6	0.301	0.246	1.153E-24	729	0.211	0.167	Q96MU6.pdb.gz	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
5	AFDB:M9PCY3	0.320	0.220	1.310E-24	878	0.220	0.145	M9PCY3.pdb.gz	M9PCY3_DROME Crooked legs, isoform G OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
6	AFDB:P17020	0.309	0.267	1.918E-24	682	0.239	0.202	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
7	AFDB:Q5T619	0.256	0.259	6.417E-24	568	0.206	0.210	Q5T619.pdb.gz	ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens OX=9606 GN=ZNF648 PE=1 SV=1
8	AFDB:A0A024R4T5	0.222	0.180	7.185E-23	734	0.217	0.170	A0A024R4T5.pdb.gz
9	AFDB:A2APF3	0.285	0.264	4.260E-22	636	0.185	0.168	A2APF3.pdb.gz	CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus OX=10090 GN=Ctcfl PE=1 SV=1
10	AFDB:Q9R1D1	0.313	0.252	1.178E-21	737	0.187	0.147	Q9R1D1.pdb.gz	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
11	PDB:3w5kB	0.087	0.258	1.432E-5	110	0.073	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7od1A	0.052	0.061	1.270E-1	430	0.045	0.060	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
13	PDB:7oniH	0.048	0.063	3.511E-1	380	0.035	0.053	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:6o9lQ	0.046	0.059	5.142E-1	430	0.052	0.070	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:4fjcE	0.055	0.068	7.065E-1	434	0.062	0.083	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:7uhyC	0.051	0.051	8.550E-1	578	0.031	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:6r5kO	0.051	0.060	1.035	447	0.028	0.036	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:5dkaA	0.057	0.248	1.252	96	0.029	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
19	PDB:7ns4b	0.066	0.094	1.515	340	0.033	0.056	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
20	PDB:4kblA	0.060	0.074	1.720	395	0.042	0.061	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TF68	0.0	1193	577	1.000	1.000	ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens OX=9606 GN=ZNF384 PE=1 SV=2
2	Q9EQJ4	0.0	1139	579	0.965	0.962	ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus OX=10116 GN=Znf384 PE=1 SV=1
3	P10073	3.25e-58	204	491	0.170	0.200	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
4	Q8WV37	6.14e-57	201	535	0.179	0.193	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
5	Q9VI93	6.71e-57	207	946	0.170	0.104	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
6	A0A1Y7VLS7	1.69e-56	194	312	0.180	0.333	A0A1Y7VLS7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
7	F8WEZ9	1.77e-56	199	492	0.179	0.209	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
8	Q3UT31	2.51e-56	194	312	0.180	0.333	Q3UT31_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Platr25 PE=2 SV=1
9	P51522	1.64e-55	197	516	0.184	0.205	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
10	A0A1Y7VJU7	4.32e-54	191	432	0.180	0.241	A0A1Y7VJU7_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
11	A0A1Y7VIZ1	4.38e-54	192	466	0.180	0.223	A0A1Y7VIZ1_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
12	A0A1Y7VIS4	4.60e-54	192	464	0.180	0.224	A0A1Y7VIS4_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1
13	Q8N988	9.13e-54	190	423	0.168	0.229	ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2
14	Q8BLE1	1.72e-53	187	338	0.177	0.302	Q8BLE1_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
15	Q923T4	2.67e-53	191	484	0.163	0.194	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
16	Q9VDZ3	2.74e-53	192	535	0.177	0.191	SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster OX=7227 GN=sqz PE=1 SV=2
17	Q15937	5.10e-53	190	498	0.170	0.197	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
18	Q8IW36	1.17e-52	189	515	0.177	0.198	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
19	Q96NG5	1.63e-52	186	402	0.166	0.239	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
20	O75467	1.64e-52	190	553	0.189	0.197	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05918 API5	85	13.4	Apoptosis inhibitory protein 5 (API5)
2	PF19268 CIS_TMP	1.9e+02	12.7	Contractile injection system tape measure protein
3	PF19108 DUF5795	40	15.5	Family of unknown function (DUF5795)
4	PF19126 DUF5810	32	16.1	Family of unknown function (DUF5810)
5	PF00096 zf-C2H2	4.9e-33	122.9	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	1.5	20.0	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	2.7e-18	76.1	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	0.013	26.7	C2H2-type zinc finger
9	PF15909 zf-C2H2_8	0.16	23.7	C2H2-type zinc ribbon
10	PF12171 zf-C2H2_jaz	0.2	23.2	Zinc-finger double-stranded RNA-binding
11	PF13913 zf-C2HC_2	0.1	23.8	zinc-finger of a C2HC-type
12	PF05605 zf-Di19	0.034	25.7	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	2.3e-33	124.3	Zinc-finger double domain
14	PF13909 zf-H2C2_5	3.1	18.9	C2H2-type zinc-finger domain
15	PF12874 zf-met	2.7e+02	13.3	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380019

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391669	0.910	Breast cancer anti-estrogen resistance protein 1
2	9606.ENSP00000359215	0.832	T-cell leukemia homeobox protein 1
3	9606.ENSP00000301732	0.824	ATP-binding cassette sub-family A member 3
4	9606.ENSP00000343204	0.824	Tyrosine-protein kinase JAK1
5	9606.ENSP00000248114	0.823	FAD-linked sulfhydryl oxidase ALR
6	9606.ENSP00000385722	0.821	Integrator complex subunit 1
7	9606.ENSP00000360108	0.820	Putative tyrosine-protein phosphatase auxilin
8	9606.ENSP00000356437	0.819	SAM and SH3 domain-containing protein 1
9	9606.ENSP00000312250	0.817	ADP-dependent glucokinase
10	9606.ENSP00000325674	0.817	Exocyst complex component 3-like protein
11	9606.ENSP00000367823	0.817	Protein FAM214B
12	9606.ENSP00000371211	0.817	Transmembrane protease serine 6
13	9606.ENSP00000380659	0.817	Eukaryotic translation initiation factor 4E transporter
14	9606.ENSP00000380690	0.817	BICD family-like cargo adapter 1
15	9606.ENSP00000380793	0.817	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
16	9606.ENSP00000454646	0.817	Putative sodium-coupled neutral amino acid transporter 7
17	9606.ENSP00000482968	0.817	Alstrom syndrome protein 1
18	9606.ENSP00000376141	0.816	Major facilitator superfamily domain containing 6
19	9606.ENSP00000324422	0.769	Zyxin
20	9606.ENSP00000306625	0.694	Tether containing UBX domain for GLUT4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.995	DNA-binding transcription factor activity
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000977	0.991	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.941	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.856	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.817	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.814	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0017124	0.787	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0019219	0.979	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.959	regulation of RNA metabolic process
GO:0009889	0.956	regulation of biosynthetic process
GO:0010468	0.947	regulation of gene expression
GO:0010556	0.930	regulation of macromolecule biosynthetic process
GO:0031326	0.925	regulation of cellular biosynthetic process
GO:2001141	0.922	regulation of RNA biosynthetic process
GO:0048518	0.915	positive regulation of biological process
GO:0009987	0.897	cellular process
GO:0006355	0.895	regulation of DNA-templated transcription
GO:0048522	0.773	positive regulation of cellular process
GO:0031325	0.658	positive regulation of cellular metabolic process
GO:0010604	0.656	positive regulation of macromolecule metabolic process
GO:0051173	0.649	positive regulation of nitrogen compound metabolic process
GO:0045935	0.565	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.507	positive regulation of cellular biosynthetic process
GO:0010557	0.451	positive regulation of macromolecule biosynthetic process
GO:0006357	0.418	regulation of transcription by RNA polymerase II
GO:0045893	0.383	positive regulation of DNA-templated transcription
GO:0032502	0.344	developmental process
GO:0050896	0.307	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.898	organelle lumen
GO:0070013	0.883	intracellular organelle lumen
GO:0005737	0.757	cytoplasm
GO:0030054	0.750	cell junction
GO:0005654	0.650	nucleoplasm
GO:0070161	0.629	anchoring junction
GO:0030055	0.559	cell-substrate junction
GO:0005925	0.513	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]