StarFunc result for job id Q8TF72

User Input

>input (1996 residues)
MMRTTEDFHKPSATLNSNTATKGRYIYLEAFLEGGAPWGFTLKGGLEHGEPLIISKVEEG
GKADTLSSKLQAGDEVVHINEVTLSSSRKEAVSLVKGSYKTLRLVVRRDVCTDPGHADTG
ASNFVSPEHLTSGPQHRKAAWSGGVKLRLKHRRSEPAGRPHSWHTTKSGEKQPDASMMQI
SQGMIGPPWHQSYHSSSSTSDLSNYDHAYLRRSPDQCSSQGSMESLEPSGAYPPCHLSPA
KSTGSIDQLSHFHNKRDSAYSSFSTSSSILEYPHPGISGRERSGSMDNTSARGGLLEGMR
QADIRYVKTVYDTRRGVSAEYEVNSSALLLQGREARASANGQGYDKWSNIPRGKGVPPPS
WSQQCPSSLETATDNLPPKVGAPLPPARSDSYAAFRHRERPSSWSSLDQKRLCRPQANSL
GSLKSPFIEEQLHTVLEKSPENSPPVKPKHNYTQKAQPGQPLLPTSIYPVPSLEPHFAQV
PQPSVSSNGMLYPALAKESGYIAPQGACNKMATIDENGNQNGSGRPGFAFCQPLEHDLLS
PVEKKPEATAKYVPSKVHFCSVPENEEDASLKRHLTPPQGNSPHSNERKSTHSNKPSSHP
HSLKCPQAQAWQAGEDKRSSRLSEPWEGDFQEDHNANLWRRLEREGLGQSLSGNFGKTKS
AFSSLQNIPESLRRHSSLELGRGTQEGYPGGRPTCAVNTKAEDPGRKAAPDLGSHLDRQV
SYPRPEGRTGASASFNSTDPSPEEPPAPSHPHTSSLGRRGPGPGSASALQGFQYGKPHCS
VLEKVSKFEQREQGSQRPSVGGSGFGHNYRPHRTVSTSSTSGNDFEETKAHIRFSESAEP
LGNGEQHFKNGELKLEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPER
EPEWRDRPGSPESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLELGAPVASRSWRPR
PSSAHVGLRSPEASASASPHTPRERHSVTPAEGDLARPVPPAARRGARRRLTPEQKKRSY
SEPEKMNEVGIVEEAEPAPLGPQRNGMRFPESSVADRRRLFERDGKACSTLSLSGPELKQ
FQQSALADYIQRKTGKRPTSAAGCSLQEPGPLRERAQSAYLQPGPAALEGSGLASASSLS
SLREPSLQPRREATLLPATVAETQQAPRDRSSSFAGGRRLGERRRGDLLSGANGGTRGTQ
RGDETPREPSSWGARAGKSMSAEDLLERSDVLAGPVHVRSRSSPATADKRQDVLLGQDSG
FGLVKDPCYLAGPGSRSLSCSERGQEEMLPLFHHLTPRWGGSGCKAIGDSSVPSECPGTL
DHQRQASRTPCPRPPLAGTQGLVTDTRAAPLTPIGTPLPSAIPSGYCSQDGQTGRQPLPP
YTPAMMHRSNGHTLTQPPGPRGCEGDGPEHGVEEGTRKRVSLPQWPPPSRAKWAHAARED
SLPEESSAPDFANLKHYQKQQSLPSLCSTSDPDTPLGAPSTPGRISLRISESVLRDSPPP
HEDYEDEVFVRDPHPKATSSPTFEPLPPPPPPPPSQETPVYSMDDFPPPPPHTVCEAQLD
SEDPEGPRPSFNKLSKVTIARERHMPGAAHVVGSQTLASRLQTSIKGSEAESTPPSFMSV
HAQLAGSLGGQPAPIQTQSLSHDPVSGTQGLEKKVSPDPQKSSEDIRTEALAKEIVHQDK
SLADILDPDSRLKTTMDLMEGLFPRDVNLLKENSVKRKAIQRTVSSSGCEGKRNEDKEAV
SMLVNCPAYYSVSAPKAELLNKIKEMPAEVNEEEEQADVNEKKAELIGSLTHKLETLQEA
KGSLLTDIKLNNALGEEVEALISELCKPNEFDKYRMFIGDLDKVVNLLLSLSGRLARVEN
VLSGLGEDASNEERSSLYEKRKILAGQHEDARELKENLDRRERVVLGILANYLSEEQLQD
YQHFVKMKSTLLIEQRKLDDKIKLGQEQVKCLLESLPSDFIPKAGALALPPNLTSEPIPA
GGCTFSGIFPTLTSPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QXN0	0.293	0.294	0.000	1986	0.717	0.721	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
2	AFDB:Q13796	0.140	0.170	2.897E-49	1616	0.270	0.334	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
3	AFDB:A2ALU4	0.145	0.192	4.660E-49	1481	0.261	0.352	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
4	AFDB:Q09JY9	0.135	0.154	5.072E-45	1726	0.254	0.293	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
5	AFDB:A0A0R4IS11	0.072	0.086	1.899E-44	1565	0.299	0.381	A0A0R4IS11.pdb.gz
6	AFDB:Q9ULL8	0.104	0.137	9.072E-30	1493	0.225	0.301	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
7	AFDB:A1Z9P3	0.108	0.136	6.406E-14	1576	0.142	0.180	A1Z9P3.pdb.gz	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
8	AFDB:D4A702	0.055	0.082	5.133E-7	1262	0.118	0.186	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
9	AFDB:Q5T5U3	0.048	0.049	1.020E-6	1958	0.137	0.140	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
10	AFDB:U3JAM7	0.050	0.080	3.623E-6	1184	0.118	0.199	U3JAM7.pdb.gz	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
11	PDB:6t36A	0.041	0.836	8.573E-6	93	0.014	0.301	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
12	PDB:7qqmA	0.043	0.201	9.732E-5	413	0.011	0.053	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7pc3A	0.042	0.195	1.485E-4	405	0.013	0.062	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7p73A	0.043	0.188	2.266E-4	420	0.013	0.062	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:5n7dA	0.042	0.180	2.518E-4	423	0.012	0.057	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
16	PDB:7qqnC	0.040	0.184	3.842E-4	414	0.011	0.051	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7p70A	0.043	0.199	9.940E-4	407	0.012	0.057	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:2xkxA	0.044	0.117	1.365E-3	721	0.012	0.033	2xkxA.pdb.gz
19	PDB:7pe9I	0.042	0.251	4.361E-3	317	0.010	0.063	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
20	PDB:7pcbA	0.040	0.180	7.797E-3	415	0.011	0.053	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QXN0	0.0	2527	1986	0.715	0.719	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
2	Q27IV2	6.03e-110	392	1788	0.128	0.143	SHRM3_XENLA Protein Shroom3 OS=Xenopus laevis OX=8355 GN=shroom3 PE=2 SV=1
3	Q13796	9.91e-99	355	1616	0.090	0.111	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
4	A2ALU4	2.57e-97	350	1481	0.088	0.119	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
5	Q09JY9	2.73e-95	345	1726	0.090	0.104	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
6	Q9ULL8	2.81e-68	258	1493	0.065	0.087	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
7	Q1W617	1.32e-65	249	1475	0.064	0.086	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
8	K7X477	2.85e-65	248	1600	0.091	0.114	K7X477_DANRE Protein Shroom3 OS=Danio rerio OX=7955 GN=shroom3v2 PE=2 SV=1
9	A1Z9P3	2.65e-18	94.7	1576	0.031	0.039	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
10	Q5SX79	3.48e-13	77.4	823	0.031	0.075	SHRM1_MOUSE Protein Shroom1 OS=Mus musculus OX=10090 GN=Shroom1 PE=1 SV=2
11	A0A140LH61	3.18e-09	64.7	1151	0.018	0.030	A0A140LH61_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=1
12	F1RCC9	3.37e-09	64.7	1179	0.018	0.030	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
13	U3JAM7	8.05e-09	63.5	1184	0.017	0.029	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
14	Q91YE8	1.40e-07	59.3	1087	0.020	0.037	SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus OX=10090 GN=Synpo2 PE=1 SV=2
15	Q8BWB1	6.09e-07	57.4	975	0.017	0.035	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
16	Q6AYD6	6.23e-07	56.2	349	0.018	0.100	PDLI2_RAT PDZ and LIM domain protein 2 OS=Rattus norvegicus OX=10116 GN=Pdlim2 PE=1 SV=1
17	D4A702	1.47e-06	56.2	1262	0.016	0.025	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
18	Q9UMS6	1.72e-06	55.8	1093	0.016	0.028	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
19	Q9PU47	2.11e-06	54.3	315	0.015	0.095	PDLI3_CHICK PDZ and LIM domain protein 3 OS=Gallus gallus OX=9031 GN=PDLIM3 PE=1 SV=1
20	Q8R1G6	2.81e-06	53.9	349	0.017	0.095	PDLI2_MOUSE PDZ and LIM domain protein 2 OS=Mus musculus OX=10090 GN=Pdlim2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08688 ASD1	1e-58	210.2	Apx/Shroom domain ASD1
2	PF08687 ASD2	1.6e-108	374.3	Apx/Shroom domain ASD2
3	PF00595 PDZ	8.6e-06	37.4	PDZ domain
4	PF17820 PDZ_6	0.69	21.2	PDZ domain
5	PF02163 Peptidase_M50	6.7e+02	10.9	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317985	0.823	Rho-associated protein kinase 2
2	9606.ENSP00000382697	0.779	Rho-associated protein kinase 1
3	9606.ENSP00000334879	0.735	Ankyrin repeat domain-containing protein SOWAHB
4	9606.ENSP00000418070	0.720	Nectin-3
5	9606.ENSP00000284637	0.704	E3 ubiquitin-protein ligase SH3RF1
6	9606.ENSP00000305494	0.688	Spermatogenesis-associated protein 5-like protein 1
7	9606.ENSP00000353590	0.665	Myosin-10
8	9606.ENSP00000388169	0.619	Actin-related protein 2/3 complex subunit 4
9	9606.ENSP00000379438	0.618	Uromodulin
10	9606.ENSP00000321856	0.617	Cysteine rich with EGF like domains 1
11	9606.ENSP00000023064	0.607	B(0,+)-type amino acid transporter 1
12	9606.ENSP00000385936	0.596	Doublecortin domain-containing protein 5
13	9606.ENSP00000281537	0.584	Tight junction protein ZO-1
14	9606.ENSP00000385277	0.562	Protein phosphatase 1 regulatory subunit 29
15	9606.ENSP00000216714	0.536	DNA-(apurinic or apyrimidinic site) lyase
16	9606.ENSP00000382004	0.534	Catenin delta-1
17	9606.ENSP00000373340	0.520	Peregrin
18	9606.ENSP00000321424	0.517	Sodium-dependent phosphate transport protein 2A
19	9606.ENSP00000360899	0.503	BEN domain-containing protein 5
20	9606.ENSP00000263674	0.501	Rho guanine nucleotide exchange factor 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0044877	0.494	protein-containing complex binding
GO:0051015	0.417	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.981	regulation of biological process
GO:0032501	0.950	multicellular organismal process
GO:0060429	0.944	epithelium development
GO:0071840	0.929	cellular component organization or biogenesis
GO:0048731	0.924	system development
GO:0016043	0.919	cellular component organization
GO:0006996	0.831	organelle organization
GO:0050794	0.764	regulation of cellular process
GO:0007010	0.454	cytoskeleton organization
GO:0030036	0.437	actin cytoskeleton organization
GO:0048869	0.428	cellular developmental process
GO:0030154	0.411	cell differentiation
GO:0048468	0.378	cell development
GO:0030855	0.377	epithelial cell differentiation
GO:0009653	0.365	anatomical structure morphogenesis
GO:0022603	0.362	regulation of anatomical structure morphogenesis
GO:0002064	0.324	epithelial cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005886	0.999	plasma membrane
GO:0045177	0.996	apical part of cell
GO:0005856	0.996	cytoskeleton
GO:0005911	0.986	cell-cell junction
GO:0016324	0.986	apical plasma membrane
GO:0043296	0.965	apical junction complex
GO:0005737	0.962	cytoplasm
GO:0005912	0.962	adherens junction
GO:0043227	0.944	membrane-bounded organelle
GO:0043231	0.872	intracellular membrane-bounded organelle
GO:0005634	0.649	nucleus
GO:0070013	0.529	intracellular organelle lumen
GO:0015629	0.468	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]