StarFunc result for job id Q8TF76

User Input

>input (798 residues)
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF76	1.000	1.000	0.000	798	1.000	1.000	Q8TF76.pdb.gz	HASP_HUMAN Serine/threonine-protein kinase haspin OS=Homo sapiens OX=9606 GN=HASPIN PE=1 SV=3
2	AFDB:Q9Z0R0	0.561	0.592	8.017E-82	754	0.620	0.656	Q9Z0R0.pdb.gz	HASP_MOUSE Serine/threonine-protein kinase haspin OS=Mus musculus OX=10090 GN=Haspin PE=1 SV=3
3	PDB:6fadC	0.205	0.422	1.107E-7	359	0.070	0.156	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
4	AFDB:Q9NYV4	0.191	0.110	1.346E-7	1490	0.177	0.095	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
5	AFDB:P53739	0.192	0.175	2.281E-7	893	0.169	0.151	P53739.pdb.gz	FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPK1 PE=1 SV=1
6	AFDB:Q9HFF4	0.214	0.172	2.672E-7	1023	0.128	0.100	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2
7	PDB:4yc3A	0.194	0.474	2.861E-7	295	0.074	0.200	4yc3A.pdb.gz
8	PDB:1unlA	0.204	0.500	1.467E-6	292	0.079	0.216	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
9	AFDB:Q14004	0.194	0.112	1.880E-6	1512	0.169	0.089	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
10	PDB:4eomC	0.196	0.489	2.237E-6	276	0.075	0.217	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
11	PDB:7cgaA	0.206	0.439	4.212E-6	347	0.071	0.164	7cgaA.pdb.gz
12	PDB:7opmA	0.188	0.373	4.440E-6	362	0.070	0.155	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
13	PDB:4zhxA	0.212	0.381	6.092E-6	409	0.064	0.125	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	AFDB:G5EB22	0.194	0.152	9.148E-6	1050	0.180	0.137	G5EB22.pdb.gz	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
15	AFDB:M9PGC5	0.217	0.079	9.643E-6	2462	0.167	0.054	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
16	PDB:2zoqA	0.195	0.407	9.792E-6	352	0.074	0.168	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
17	PDB:4c0tA	0.192	0.455	1.088E-5	291	0.064	0.175	4c0tA.pdb.gz
18	PDB:6qx9K	0.206	0.461	1.088E-5	322	0.055	0.137	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	AFDB:P07527	0.205	0.189	1.130E-5	877	0.162	0.147	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
20	AFDB:Q9XTF3	0.201	0.197	1.130E-5	817	0.153	0.149	Q9XTF3.pdb.gz	MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TF76	0.0	1643	798	1.000	1.000	HASP_HUMAN Serine/threonine-protein kinase haspin OS=Homo sapiens OX=9606 GN=HASPIN PE=1 SV=3
2	Q9Z0R0	0.0	853	754	0.607	0.642	HASP_MOUSE Serine/threonine-protein kinase haspin OS=Mus musculus OX=10090 GN=Haspin PE=1 SV=3
3	P83103	6.94e-81	272	566	0.174	0.246	HASP_DROME Serine/threonine-protein kinase haspin homolog OS=Drosophila melanogaster OX=7227 GN=Haspin PE=1 SV=1
4	G5EE25	3.07e-58	216	949	0.144	0.121	G5EE25_CAEEL non-specific serine/threonine protein kinase OS=Caenorhabditis elegans OX=6239 GN=hasp-1 PE=1 SV=1
5	O80528	2.86e-54	200	599	0.149	0.199	HASP_ARATH Serine/threonine-protein kinase haspin homolog OS=Arabidopsis thaliana OX=3702 GN=HASPIN PE=1 SV=1
6	O13924	3.52e-51	188	488	0.144	0.236	HASP_SCHPO Serine/threonine-protein kinase haspin homolog hrk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrk1 PE=1 SV=1
7	P32789	1.61e-06	54.3	676	0.058	0.068	ALK2_YEAST Serine/threonine-protein kinase Haspin homolog ALK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALK2 PE=1 SV=1
8	P43633	4.14e-05	49.7	760	0.056	0.059	ALK1_YEAST Serine/threonine-protein kinase Haspin homolog ALK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALK1 PE=1 SV=2
9	Q9Y6E0	0.006	42.4	443	0.063	0.113	STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1
10	Q5U0E6	0.007	42.0	431	0.063	0.116	Q5U0E6_HUMAN Epididymis secretory protein Li 95 OS=Homo sapiens OX=9606 GN=HEL-S-95 PE=2 SV=1
11	A0A0R4IN78	0.008	42.0	432	0.060	0.111	A0A0R4IN78_DANRE Serine/threonine kinase 24b (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk24 PE=1 SV=1
12	Q8GWU3	0.008	42.4	780	0.061	0.063	Q8GWU3_ARATH At3g20200 OS=Arabidopsis thaliana OX=3702 GN=At3g20200 PE=1 SV=1
13	B0LT89	0.009	41.6	431	0.063	0.116	STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus OX=10116 GN=Stk24 PE=2 SV=1
14	D4A648	0.009	42.0	488	0.065	0.107	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
15	Q7SYN3	0.010	41.6	420	0.061	0.117	Q7SYN3_DANRE Serine/threonine kinase 24 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk24 PE=1 SV=1
16	Q13043	0.012	41.2	487	0.063	0.103	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
17	Q9JI11	0.012	41.6	487	0.063	0.103	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
18	O61122	0.014	41.2	478	0.065	0.109	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
19	Q8IGS1	0.018	40.8	642	0.059	0.073	Q8IGS1_DROME RE38276p OS=Drosophila melanogaster OX=7227 GN=GckIII PE=2 SV=1
20	Q9VEN3	0.018	40.8	642	0.059	0.073	Q9VEN3_DROME FI20177p1 OS=Drosophila melanogaster OX=7227 GN=GckIII PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12330 Haspin_kinase	3.7e-93	324.0	Haspin like kinase domain
2	PF00069 Pkinase	0.0023	28.9	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	3	18.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325290

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303427	0.959	Sister chromatid cohesion protein PDS5 homolog A
2	9606.ENSP00000313851	0.922	Sister chromatid cohesion protein PDS5 homolog B
3	9606.ENSP00000302530	0.909	Mitotic checkpoint serine/threonine-protein kinase BUB1
4	9606.ENSP00000313950	0.901	Aurora kinase B
5	9606.ENSP00000378295	0.846	Inner centromere protein
6	9606.ENSP00000287598	0.841	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
7	9606.ENSP00000263753	0.792	Shugoshin 1
8	9606.ENSP00000361298	0.788	Kinesin-like protein KIF2C
9	9606.ENSP00000362146	0.766	Borealin
10	9606.ENSP00000300093	0.764	Serine/threonine-protein kinase PLK1
11	9606.ENSP00000328228	0.755	Cell division cycle-associated protein 2
12	9606.ENSP00000358813	0.751	Dual specificity protein kinase TTK
13	9606.ENSP00000476960	0.721	Histone cluster 2 H3 pseudogene 2
14	9606.ENSP00000364585	0.697	Protein RCC2
15	9606.ENSP00000275517	0.689	Sororin
16	9606.ENSP00000336868	0.670	Histone H3-like centromeric protein A
17	9606.ENSP00000350447	0.670	Shugoshin 2
18	9606.ENSP00000251496	0.668	Condensin complex subunit 3
19	9606.ENSP00000261597	0.662	Kinetochore protein NDC80 homolog
20	9606.ENSP00000378699	0.662	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035173	1.000	histone kinase activity
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding
GO:0072354	0.883	histone H3T3 kinase activity
GO:0003676	0.343	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0006468	0.991	protein phosphorylation
GO:0051276	0.986	chromosome organization
GO:0007049	0.985	cell cycle
GO:0051128	0.984	regulation of cellular component organization
GO:0098813	0.984	nuclear chromosome segregation
GO:0000280	0.984	nuclear division
GO:1901988	0.981	negative regulation of cell cycle phase transition
GO:0050896	0.977	response to stimulus
GO:1903047	0.976	mitotic cell cycle process
GO:0007154	0.975	cell communication
GO:0051716	0.973	cellular response to stimulus
GO:0033043	0.970	regulation of organelle organization
GO:1901991	0.958	negative regulation of mitotic cell cycle phase transition
GO:0051641	0.950	cellular localization
GO:0000819	0.944	sister chromatid segregation
GO:0033044	0.931	regulation of chromosome organization
GO:0035556	0.927	intracellular signal transduction
GO:0140014	0.897	mitotic nuclear division
GO:0051129	0.884	negative regulation of cellular component organization
GO:0033045	0.868	regulation of sister chromatid segregation
GO:0051783	0.865	regulation of nuclear division
GO:0007088	0.863	regulation of mitotic nuclear division
GO:0010639	0.852	negative regulation of organelle organization
GO:1902099	0.847	regulation of metaphase/anaphase transition of cell cycle
GO:0033047	0.845	regulation of mitotic sister chromatid segregation
GO:0000070	0.842	mitotic sister chromatid segregation
GO:0030071	0.833	regulation of mitotic metaphase/anaphase transition
GO:0007093	0.818	mitotic cell cycle checkpoint signaling
GO:0010965	0.816	regulation of mitotic sister chromatid separation
GO:2001251	0.815	negative regulation of chromosome organization
GO:0051985	0.809	negative regulation of chromosome segregation
GO:0051784	0.800	negative regulation of nuclear division
GO:0008104	0.780	protein localization
GO:0045841	0.776	negative regulation of mitotic metaphase/anaphase transition
GO:0034502	0.773	protein localization to chromosome
GO:0007062	0.739	sister chromatid cohesion
GO:0007094	0.728	mitotic spindle assembly checkpoint signaling
GO:0071459	0.308	protein localization to chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0015630	0.990	microtubule cytoskeleton
GO:0005737	0.962	cytoplasm
GO:0005829	0.948	cytosol
GO:0005819	0.912	spindle
GO:0005815	0.793	microtubule organizing center
GO:0005813	0.784	centrosome
GO:0005694	0.739	chromosome
GO:0098687	0.599	chromosomal region
GO:0000775	0.557	chromosome, centromeric region
GO:0032991	0.483	protein-containing complex
GO:0000793	0.378	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]