StarFunc result for job id Q8WTR2

User Input

>input (217 residues)
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDL
SSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDL
PETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLV
KNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WTR2	1.000	1.000	2.959E-45	217	1.000	1.000	Q8WTR2.pdb.gz	DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens OX=9606 GN=DUSP19 PE=1 SV=1
2	AFDB:Q8K4T5	0.716	0.707	4.844E-38	220	0.816	0.805	Q8K4T5.pdb.gz	DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus OX=10090 GN=Dusp19 PE=2 SV=1
3	AFDB:Q9NGL1	0.620	0.660	1.380E-18	203	0.355	0.379	Q9NGL1.pdb.gz	Q9NGL1_DROME MAP kinase phosphatase-1 OS=Drosophila melanogaster OX=7227 GN=Mkp PE=2 SV=1
4	AFDB:Q99956	0.665	0.382	4.211E-17	384	0.286	0.161	Q99956.pdb.gz	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
5	AFDB:Q9ESS0	0.648	0.297	5.352E-17	483	0.272	0.122	Q9ESS0.pdb.gz	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
6	AFDB:Q6NN85	0.675	0.144	6.803E-17	1045	0.263	0.055	Q6NN85.pdb.gz	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
7	AFDB:Q556Y8	0.645	0.305	7.223E-17	476	0.253	0.116	Q556Y8.pdb.gz	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
8	AFDB:Q8TE77	0.676	0.227	1.167E-16	659	0.253	0.083	Q8TE77.pdb.gz	SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2
9	AFDB:Q9ZR37	0.675	0.739	1.167E-16	198	0.272	0.298	Q9ZR37.pdb.gz	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
10	AFDB:Q9M8K7	0.649	0.840	1.886E-16	167	0.244	0.317	Q9M8K7.pdb.gz	DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana OX=3702 GN=DSPTP1B PE=1 SV=1
11	PDB:2esbA	0.607	0.806	3.549E-15	162	0.212	0.284	2esbA.pdb.gz
12	PDB:2wgpA	0.619	0.793	1.045E-14	168	0.217	0.280	2wgpA.pdb.gz
13	PDB:6d66A	0.625	0.265	1.250E-14	517	0.230	0.097	6d66A.pdb.gz
14	PDB:5y15A	0.617	0.889	4.850E-13	148	0.203	0.297	5y15A.pdb.gz
15	PDB:3f81A	0.629	0.758	3.305E-12	179	0.230	0.279	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
16	PDB:2gwoC	0.609	0.749	1.313E-11	174	0.235	0.293	2gwoC.pdb.gz
17	PDB:2y96A	0.625	0.768	3.426E-11	175	0.212	0.263	2y96A.pdb.gz
18	PDB:5xjvB	0.584	0.733	8.423E-11	171	0.212	0.269	5xjvB.pdb.gz
19	PDB:2q05A	0.553	0.654	2.830E-8	181	0.152	0.182	2q05A.pdb.gz
20	PDB:4ercA	0.524	0.736	4.055E-8	150	0.101	0.147	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WTR2	3.86e-164	452	217	1.000	1.000	DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens OX=9606 GN=DUSP19 PE=1 SV=1
2	Q8K4T5	5.42e-135	379	220	0.820	0.809	DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus OX=10090 GN=Dusp19 PE=2 SV=1
3	Q9NGL1	1.84e-33	120	203	0.318	0.340	Q9NGL1_DROME MAP kinase phosphatase-1 OS=Drosophila melanogaster OX=7227 GN=Mkp PE=2 SV=1
4	Q9ZR37	7.96e-32	116	198	0.267	0.293	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
5	Q9M8K7	4.26e-31	114	167	0.244	0.317	DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana OX=3702 GN=DSPTP1B PE=1 SV=1
6	Q55E39	1.36e-26	103	212	0.295	0.302	DUSP1_DICDI Probable dual specificity protein phosphatase DDB_G0269404 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269404 PE=3 SV=1
7	Q6NN85	3.24e-26	107	1045	0.249	0.052	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
8	Q8TE77	1.14e-25	106	659	0.249	0.082	SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2
9	V6CIV8	5.84e-25	102	381	0.249	0.142	DUSL_CAEEL Dual specificity protein phosphatase lip-1 OS=Caenorhabditis elegans OX=6239 GN=lip-1 PE=1 SV=1
10	Q7SZF3	8.41e-25	102	367	0.249	0.147	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
11	Q16829	1.81e-24	101	419	0.263	0.136	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
12	Q9VVW5	2.87e-24	100	411	0.230	0.122	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
13	Q8R4V2	3.01e-24	97.8	235	0.230	0.213	DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus OX=10090 GN=Dusp15 PE=1 SV=3
14	A0A1D8PSH7	3.65e-24	99.4	322	0.253	0.171	A0A1D8PSH7_CANAL protein-tyrosine-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YVH1 PE=3 SV=1
15	Q05923	4.45e-24	99.4	314	0.249	0.172	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
16	Q556Y8	4.62e-24	100	476	0.207	0.095	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
17	B4F7B7	7.37e-24	97.1	236	0.226	0.208	DUS15_RAT Dual specificity protein phosphatase 15 OS=Rattus norvegicus OX=10116 GN=Dusp15 PE=2 SV=1
18	Q9VWF4	1.94e-23	98.6	387	0.272	0.152	DUSK4_DROME Dual specificity protein phosphatase MPK-4 OS=Drosophila melanogaster OX=7227 GN=MKP-4 PE=1 SV=1
19	Q05922	2.04e-23	97.4	318	0.244	0.167	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
20	Q8WUJ0	3.81e-23	94.7	223	0.244	0.238	STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens OX=9606 GN=STYX PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	4.9e-30	115.5	Dual specificity phosphatase, catalytic domain
2	PF04179 Init_tRNA_PT	3.8e+02	12.8	Rit1 DUSP-like domain
3	PF00102 Y_phosphatase	1.8	19.6	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346160

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381070	0.778	Dual specificity mitogen-activated protein kinase kinase 7
2	9606.ENSP00000378416	0.742	5-aminolevulinate synthase, nonspecific, mitochondrial
3	9606.ENSP00000421981	0.717	Progestin and adipoQ receptor family member 3
4	9606.ENSP00000354251	0.696	Nck-associated protein 1
5	9606.ENSP00000386563	0.665	MORN repeat-containing protein 2
6	9606.ENSP00000394560	0.640	Mitogen-activated protein kinase 9
7	9606.ENSP00000351908	0.625	Mitogen-activated protein kinase kinase kinase 5
8	9606.ENSP00000401197	0.583	Ubiquitin carboxyl-terminal hydrolase 19
9	9606.ENSP00000366934	0.536	Polynucleotide 5'-hydroxyl-kinase NOL9
10	9606.ENSP00000410402	0.519	Dual specificity mitogen-activated protein kinase kinase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0019899	0.505	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.971	primary metabolic process
GO:0044237	0.971	cellular metabolic process
GO:0043170	0.971	macromolecule metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0050794	0.966	regulation of cellular process
GO:1901564	0.964	organonitrogen compound metabolic process
GO:0043412	0.957	macromolecule modification
GO:0050896	0.948	response to stimulus
GO:0048583	0.947	regulation of response to stimulus
GO:0043408	0.943	regulation of MAPK cascade
GO:0006470	0.942	protein dephosphorylation
GO:0048518	0.937	positive regulation of biological process
GO:0000165	0.925	MAPK cascade
GO:0048523	0.871	negative regulation of cellular process
GO:0051338	0.812	regulation of transferase activity
GO:0009968	0.795	negative regulation of signal transduction
GO:0019222	0.787	regulation of metabolic process
GO:0009893	0.774	positive regulation of metabolic process
GO:0048522	0.770	positive regulation of cellular process
GO:0006950	0.767	response to stress
GO:0042325	0.759	regulation of phosphorylation
GO:0070302	0.754	regulation of stress-activated protein kinase signaling cascade
GO:0001932	0.754	regulation of protein phosphorylation
GO:0033554	0.749	cellular response to stress
GO:0010604	0.743	positive regulation of macromolecule metabolic process
GO:0071901	0.698	negative regulation of protein serine/threonine kinase activity
GO:0031098	0.696	stress-activated protein kinase signaling cascade
GO:0032872	0.692	regulation of stress-activated MAPK cascade
GO:0051173	0.646	positive regulation of nitrogen compound metabolic process
GO:0043405	0.605	regulation of MAP kinase activity
GO:0043407	0.603	negative regulation of MAP kinase activity
GO:0031325	0.586	positive regulation of cellular metabolic process
GO:0051247	0.474	positive regulation of protein metabolic process
GO:0051347	0.463	positive regulation of transferase activity
GO:0051403	0.343	stress-activated MAPK cascade
GO:0043410	0.302	positive regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005829	0.952	cytosol
GO:0005634	0.935	nucleus
GO:0016020	0.874	membrane
GO:0070013	0.839	intracellular organelle lumen
GO:0031981	0.784	nuclear lumen
GO:0005654	0.764	nucleoplasm
GO:0005886	0.468	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]