StarFunc result for job id Q8WTR4

User Input

>input (605 residues)
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLY
FWWEVHNDYDEFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNL
HWLHKIGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVA
GQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA
PEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML
NWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLR
DPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS
LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHA
LSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVR
RTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLI
ERSGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q640M6	0.914	0.911	4.852E-92	607	0.907	0.904	Q640M6.pdb.gz	GDPD5_MOUSE Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1
2	AFDB:Q3KTM2	0.876	0.885	2.578E-77	599	0.681	0.688	Q3KTM2.pdb.gz	GDPD5_CHICK Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Gallus gallus OX=9031 GN=GDPD5 PE=1 SV=1
3	AFDB:E7EY39	0.863	0.894	1.032E-71	584	0.577	0.598	E7EY39.pdb.gz
4	AFDB:A0A2R8QBH7	0.809	0.788	4.234E-60	621	0.483	0.470	A0A2R8QBH7.pdb.gz
5	AFDB:Q9ESM6	0.829	0.927	2.425E-51	539	0.380	0.427	Q9ESM6.pdb.gz	GDPD2_MOUSE Glycerophosphoinositol inositolphosphodiesterase GDPD2 OS=Mus musculus OX=10090 GN=Gdpd2 PE=1 SV=1
6	AFDB:E9QG52	0.372	0.692	2.659E-32	316	0.311	0.595	E9QG52.pdb.gz
7	AFDB:P10908	0.332	0.752	1.003E-12	247	0.091	0.223	P10908.pdb.gz	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
8	AFDB:Q9NZC3	0.323	0.573	1.098E-10	331	0.104	0.190	Q9NZC3.pdb.gz	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
9	AFDB:Q9JL55	0.314	0.555	1.713E-10	331	0.112	0.205	Q9JL55.pdb.gz	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
10	AFDB:Q08959	0.332	0.600	5.609E-10	321	0.084	0.159	Q08959.pdb.gz	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
11	PDB:4gnkB	0.237	0.193	6.275E-3	769	0.060	0.047	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:3gfxB	0.168	0.242	6.593E-3	394	0.045	0.069	3gfxB.pdb.gz	Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase.
13	PDB:1ec9D	0.169	0.217	3.539E-2	444	0.045	0.061	1ec9D.pdb.gz	Evolution of enzymatic activities in the enolase superfamily: crystallographic and mutagenesis studies of the reaction catalyzed by D-glucarate dehydratase from Escherichia coli.
14	PDB:3cq0A	0.230	0.389	3.907E-2	325	0.058	0.108	3cq0A.pdb.gz
15	PDB:3gfyB	0.146	0.225	4.532E-2	374	0.046	0.075	3gfyB.pdb.gz	Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase.
16	PDB:6arhB	0.183	0.306	4.761E-2	303	0.058	0.116	6arhB.pdb.gz
17	PDB:4qccA	0.161	0.323	7.805E-2	270	0.053	0.119	4qccA.pdb.gz
18	PDB:6jigA	0.157	0.191	1.050E-1	480	0.058	0.073	6jigA.pdb.gz	Allosteric regulation accompanied by oligomeric state changes of Trypanosoma brucei GMP reductase through cystathionine-beta-synthase domain.
19	PDB:3kofA	0.223	0.391	1.279E-1	316	0.056	0.108	3kofA.pdb.gz	Redesigning the Active Site of Transaldolase TalB from Escherichia coli: New Variants with Improved Affinity towards Nonphosphorylated Substrates.
20	PDB:6uajA	0.143	0.172	1.412E-1	489	0.036	0.045	6uajA.pdb.gz	Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q763	0.0	736	579	0.580	0.606	A0A2R8Q763_DANRE Glycerophosphodiester phosphodiesterase domain-containing 5b OS=Danio rerio OX=7955 GN=gdpd5b PE=1 SV=1
2	E7FGJ8	0.0	672	600	0.527	0.532	E7FGJ8_DANRE Glycerophosphodiester phosphodiesterase domain-containing 5a OS=Danio rerio OX=7955 GN=gdpd5a PE=3 SV=2
3	Q3KTM2	0.0	892	599	0.679	0.686	GDPD5_CHICK Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Gallus gallus OX=9031 GN=GDPD5 PE=1 SV=1
4	Q640M6	0.0	1149	607	0.907	0.904	GDPD5_MOUSE Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1
5	Q8WTR4	0.0	1248	605	1.000	1.000	GDPD5_HUMAN Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=GDPD5 PE=1 SV=2
6	Q9ESM6	7.86e-127	385	539	0.369	0.414	GDPD2_MOUSE Glycerophosphoinositol inositolphosphodiesterase GDPD2 OS=Mus musculus OX=10090 GN=Gdpd2 PE=1 SV=1
7	P10908	2.44e-09	60.5	247	0.056	0.138	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
8	Q9JL56	1.07e-08	59.7	331	0.051	0.094	GDE1_MOUSE Glycerophosphodiester phosphodiesterase 1 OS=Mus musculus OX=10090 GN=Gde1 PE=1 SV=1
9	Q9JL55	1.12e-08	59.3	331	0.051	0.094	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
10	Q9NZC3	3.15e-08	58.2	331	0.050	0.091	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
11	Q9C907	4.53e-06	51.6	392	0.051	0.079	GDPD5_ARATH Glycerophosphodiester phosphodiesterase GDPD5 OS=Arabidopsis thaliana OX=3702 GN=GDPD5 PE=2 SV=1
12	P09394	4.67e-05	48.1	358	0.041	0.070	GLPQ_ECOLI Glycerophosphodiester phosphodiesterase, periplasmic OS=Escherichia coli (strain K12) OX=83333 GN=glpQ PE=1 SV=2
13	Q8IM31	0.026	39.7	475	0.030	0.038	Q8IM31_PLAF7 Glycerophosphodiester phosphodiesterase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1406300 PE=4 SV=1
14	F4HQ30	0.029	40.0	785	0.056	0.043	F4HQ30_ARATH glycerophosphodiester phosphodiesterase OS=Arabidopsis thaliana OX=3702 GN=SVL2 PE=1 SV=1
15	Q7Y208	0.031	39.7	763	0.055	0.043	GPDL1_ARATH Glycerophosphodiester phosphodiesterase GDPDL1 OS=Arabidopsis thaliana OX=3702 GN=GDPDL1 PE=1 SV=2
16	Q59S57	0.087	38.1	405	0.026	0.040	Q59S57_CANAL Phosphatidylglycerol phospholipase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C602420WA PE=4 SV=1
17	Q9FJ62	0.093	38.1	766	0.055	0.043	GPDL4_ARATH Glycerophosphodiester phosphodiesterase GDPDL4 OS=Arabidopsis thaliana OX=3702 GN=GDPDL4 PE=1 SV=1
18	Q8C0L9	0.20	37.4	675	0.069	0.062	GPCP1_MOUSE Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus OX=10090 GN=Gpcpd1 PE=1 SV=1
19	Q08959	0.26	36.2	321	0.026	0.050	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
20	M9PI96	0.78	35.0	649	0.035	0.032	M9PI96_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18135 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03009 GDPD	2.4e-13	62.0	Glycerophosphoryl diester phosphodiesterase family
2	PF13653 GDPD_2	0.12	24.1	Glycerophosphoryl diester phosphodiesterase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337972

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262746	0.842	Peroxiredoxin-1
2	9606.ENSP00000290759	0.734	Insulin gene enhancer protein ISL-2
3	9606.ENSP00000252971	0.730	Motor neuron and pancreas homeobox protein 1
4	9606.ENSP00000368305	0.695	Glycerophosphocholine phosphodiesterase GPCPD1
5	9606.ENSP00000284116	0.687	Lysophospholipase D GDPD1
6	9606.ENSP00000357927	0.683	Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
7	9606.ENSP00000278618	0.601	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
8	9606.ENSP00000230658	0.582	Insulin gene enhancer protein ISL-1
9	9606.ENSP00000331040	0.540	Oligodendrocyte transcription factor 2
10	9606.ENSP00000301522	0.538	Peroxiredoxin-2
11	9606.ENSP00000347198	0.526	SLIT-ROBO Rho GTPase-activating protein 1
12	9606.ENSP00000386722	0.516	FCH and double SH3 domains 2
13	9606.ENSP00000367202	0.513	Reversion-inducing cysteine-rich protein with Kazal motifs

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008081	1.000	phosphoric diester hydrolase activity
GO:0005515	0.998	protein binding
GO:0047389	0.354	glycerophosphocholine phosphodiesterase activity
GO:0008889	0.322	glycerophosphodiester phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.955	biological regulation
GO:0050794	0.946	regulation of cellular process
GO:0009987	0.899	cellular process
GO:0048518	0.865	positive regulation of biological process
GO:0048522	0.858	positive regulation of cellular process
GO:0045595	0.725	regulation of cell differentiation
GO:0045664	0.648	regulation of neuron differentiation
GO:0045597	0.607	positive regulation of cell differentiation
GO:0045666	0.466	positive regulation of neuron differentiation
GO:0032502	0.395	developmental process
GO:0048856	0.351	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0043227	0.984	membrane-bounded organelle
GO:0005737	0.984	cytoplasm
GO:0012505	0.980	endomembrane system
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005886	0.845	plasma membrane
GO:0031090	0.810	organelle membrane
GO:0005829	0.652	cytosol
GO:0005783	0.444	endoplasmic reticulum
GO:0005789	0.406	endoplasmic reticulum membrane
GO:0031982	0.367	vesicle
GO:0042995	0.323	cell projection
GO:0070013	0.321	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.
RHEA:16061	0.354	H2O + sn-glycerol 3-phosphocholine = choline + H(+) + sn-glycerol 3-phosphate
EC:3.1.4.2	0.354	glycerophosphocholine phosphodiesterase.
RHEA:12969	0.322	a sn-glycero-3-phosphodiester + H2O = an alcohol + H(+) + sn-glycerol 3-phosphate
EC:3.1.4.46	0.322	glycerophosphodiester phosphodiesterase.

[back to server]