StarFunc result for job id Q8WTS1

User Input

>input (349 residues)
MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNG
NKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRF
DSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWG
FPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMF
EDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCI
DGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6QA69	0.957	0.952	9.793E-67	351	0.940	0.934	Q6QA69.pdb.gz	ABHD5_RAT 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus OX=10116 GN=Abhd5 PE=1 SV=1
2	AFDB:Q8TB40	0.901	0.918	7.544E-47	342	0.533	0.544	Q8TB40.pdb.gz	ABHD4_HUMAN (Lyso)-N-acylphosphatidylethanolamine lipase OS=Homo sapiens OX=9606 GN=ABHD4 PE=1 SV=1
3	AFDB:A0A2U3TZT9	0.672	0.834	1.615E-43	278	0.736	0.924	A0A2U3TZT9.pdb.gz	A0A2U3TZT9_HUMAN Abhydrolase domain containing 5, lysophosphatidic acid acyltransferase OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1
4	AFDB:Q5U191	0.897	0.693	6.873E-42	454	0.458	0.352	Q5U191.pdb.gz	Q5U191_DROME Pummelig, isoform A OS=Drosophila melanogaster OX=7227 GN=puml PE=1 SV=1
5	AFDB:O02218	0.867	0.841	2.624E-33	360	0.352	0.342	O02218.pdb.gz	LID1_CAEEL Abhydrolase domain-containing protein lid-1 OS=Caenorhabditis elegans OX=6239 GN=lid-1 PE=1 SV=2
6	AFDB:Q581X1	0.863	0.844	8.729E-29	357	0.315	0.308	Q581X1.pdb.gz	Q581X1_TRYB2 AB hydrolase-1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.650 PE=4 SV=1
7	AFDB:O22975	0.797	0.671	2.969E-27	418	0.318	0.266	O22975.pdb.gz	LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=At4g24160 PE=1 SV=1
8	AFDB:O14249	0.807	0.665	7.216E-26	428	0.301	0.245	O14249.pdb.gz	CLD1_SCHPO Probable cardiolipin-specific deacylase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.03c PE=3 SV=1
9	AFDB:Q12385	0.748	0.668	2.418E-22	394	0.229	0.203	Q12385.pdb.gz	ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ICT1 PE=3 SV=1
10	AFDB:P53264	0.764	0.609	4.201E-21	445	0.252	0.198	P53264.pdb.gz	CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLD1 PE=1 SV=1
11	PDB:5jzsB	0.594	0.710	2.047E-14	284	0.166	0.204	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
12	PDB:3kxpA	0.576	0.734	1.441E-12	268	0.140	0.183	3kxpA.pdb.gz
13	PDB:5aljA	0.577	0.402	2.385E-12	523	0.163	0.109	5aljA.pdb.gz	Successful Generation of Structural Information for Fragment-Based Drug Discovery.
14	PDB:1cr6B	0.585	0.391	3.732E-12	541	0.175	0.113	1cr6B.pdb.gz	Detoxification of environmental mutagens and carcinogens: structure, mechanism, and evolution of liver epoxide hydrolase.
15	PDB:3bf7A	0.525	0.700	6.533E-12	255	0.155	0.212	3bf7A.pdb.gz
16	PDB:4haiA	0.568	0.379	6.533E-12	548	0.178	0.113	4haiA.pdb.gz	Synthesis and structure-activity relationship of piperidine-derived non-urea soluble epoxide hydrolase inhibitors.
17	PDB:2ocgA	0.520	0.694	1.143E-11	254	0.140	0.193	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
18	PDB:6ap6A	0.546	0.697	1.143E-11	264	0.129	0.170	6ap6A.pdb.gz	Inhibition of strigolactone receptors byN-phenylanthranilic acid derivatives: Structural and functional insights.
19	PDB:1u2eA	0.580	0.691	1.209E-11	286	0.149	0.182	1u2eA.pdb.gz
20	PDB:3afiB	0.545	0.617	1.600E-11	302	0.138	0.159	3afiB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5D6	0.0	728	349	1.000	1.000	A0A0S2Z5D6_HUMAN Abhydrolase domain containing 5 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ABHD5 PE=2 SV=1
2	A0A2U3TZT9	0.0	537	278	0.736	0.924	A0A2U3TZT9_HUMAN Abhydrolase domain containing 5, lysophosphatidic acid acyltransferase OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1
3	Q6QA69	0.0	651	351	0.940	0.934	ABHD5_RAT 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus OX=10116 GN=Abhd5 PE=1 SV=1
4	Q8WTS1	0.0	728	349	1.000	1.000	ABHD5_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1
5	Q9DBL9	0.0	652	351	0.943	0.937	ABHD5_MOUSE 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Mus musculus OX=10090 GN=Abhd5 PE=1 SV=1
6	Q8TB40	3.38e-141	405	342	0.530	0.541	ABHD4_HUMAN (Lyso)-N-acylphosphatidylethanolamine lipase OS=Homo sapiens OX=9606 GN=ABHD4 PE=1 SV=1
7	Q8VD66	1.14e-140	404	342	0.530	0.541	ABHD4_MOUSE (Lyso)-N-acylphosphatidylethanolamine lipase OS=Mus musculus OX=10090 GN=Abhd4 PE=1 SV=1
8	Q5U191	3.79e-113	338	454	0.467	0.359	Q5U191_DROME Pummelig, isoform A OS=Drosophila melanogaster OX=7227 GN=puml PE=1 SV=1
9	Q7JQU9	1.67e-110	329	387	0.447	0.403	Q7JQU9_DROME AT25873p OS=Drosophila melanogaster OX=7227 GN=puml PE=1 SV=1
10	O02218	4.08e-81	253	360	0.367	0.356	LID1_CAEEL Abhydrolase domain-containing protein lid-1 OS=Caenorhabditis elegans OX=6239 GN=lid-1 PE=1 SV=2
11	Q581X1	2.36e-45	160	357	0.330	0.322	Q581X1_TRYB2 AB hydrolase-1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.650 PE=4 SV=1
12	O22975	1.21e-40	149	418	0.304	0.254	LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=At4g24160 PE=1 SV=1
13	O14249	7.35e-31	123	428	0.278	0.227	CLD1_SCHPO Probable cardiolipin-specific deacylase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.03c PE=3 SV=1
14	Q12385	2.11e-17	84.7	394	0.221	0.195	ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ICT1 PE=3 SV=1
15	P53264	1.71e-11	67.4	445	0.152	0.119	CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLD1 PE=1 SV=1
16	P9WNH3	2.71e-11	66.2	341	0.183	0.188	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1
17	O23227	5.12e-11	65.5	378	0.100	0.093	O23227_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=C7A10.830 PE=1 SV=2
18	Q04623	5.74e-11	65.9	453	0.218	0.168	ECM18_YEAST Protein ECM18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM18 PE=1 SV=1
19	O53321	6.75e-09	58.5	299	0.206	0.241	O53321_MYCTU Possible non-heme haloperoxidase Hpx OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hpx PE=1 SV=3
20	Q1QEU6	1.40e-08	57.8	315	0.132	0.146	Q1QEU6_PSYCK Alpha/beta hydrolase fold protein OS=Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5) OX=335284 GN=Pcryo_0023 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	1.3e-15	69.4	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	1.1e-12	60.6	Alpha/beta hydrolase family
3	PF06378 DUF1071	6e+02	11.4	Protein of unknown function (DUF1071)
4	PF12146 Hydrolase_4	7.9e-07	40.1	Serine aminopeptidase, S33
5	PF03096 Ndr	8.3	16.6	Ndr family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300055	0.999	Perilipin-1
2	9606.ENSP00000337701	0.999	Patatin-like phospholipase domain-containing protein 2
3	9606.ENSP00000371272	0.989	Perilipin-5
4	9606.ENSP00000380184	0.958	Glycerol-3-phosphate acyltransferase 4
5	9606.ENSP00000482571	0.947	Glycerol-3-phosphate acyltransferase 3
6	9606.ENSP00000265276	0.944	Glycerol-3-phosphate acyltransferase 1, mitochondrial
7	9606.ENSP00000276914	0.938	Perilipin-2
8	9606.ENSP00000389395	0.934	Glycerol-3-phosphate acyltransferase 2, mitochondrial
9	9606.ENSP00000295887	0.918	Phosphatidate cytidylyltransferase 1
10	9606.ENSP00000378072	0.917	Patatin-like phospholipase domain-containing protein 1
11	9606.ENSP00000419879	0.915	Phosphatidate cytidylyltransferase 2
12	9606.ENSP00000360296	0.908	Phospholipid phosphatase 3
13	9606.ENSP00000264775	0.907	Phospholipid phosphatase 1
14	9606.ENSP00000329697	0.907	Phospholipid phosphatase 2
15	9606.ENSP00000352962	0.907	Lipid phosphate phosphatase-related protein type 3
16	9606.ENSP00000359204	0.907	Phospholipid phosphatase-related protein type 4
17	9606.ENSP00000381302	0.907	Phospholipid phosphatase 4
18	9606.ENSP00000466898	0.907	Lipid phosphate phosphatase-related protein type 2
19	9606.ENSP00000244289	0.892	Hormone-sensitive lipase
20	9606.ENSP00000216180	0.872	Patatin-like phospholipase domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	1.000	protein binding
GO:0016787	0.888	hydrolase activity
GO:0016788	0.619	hydrolase activity, acting on ester bonds
GO:0052689	0.402	carboxylic ester hydrolase activity
GO:0016298	0.316	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0032879	0.989	regulation of localization
GO:0006629	0.988	lipid metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0010883	0.968	regulation of lipid storage
GO:1905953	0.965	negative regulation of lipid localization
GO:0019216	0.964	regulation of lipid metabolic process
GO:0050794	0.953	regulation of cellular process
GO:0048518	0.953	positive regulation of biological process
GO:0009894	0.917	regulation of catabolic process
GO:0048522	0.853	positive regulation of cellular process
GO:0009893	0.852	positive regulation of metabolic process
GO:0044255	0.836	cellular lipid metabolic process
GO:0031323	0.825	regulation of cellular metabolic process
GO:0045834	0.781	positive regulation of lipid metabolic process
GO:0050994	0.751	regulation of lipid catabolic process
GO:0090207	0.742	regulation of triglyceride metabolic process
GO:0050996	0.679	positive regulation of lipid catabolic process
GO:0031331	0.651	positive regulation of cellular catabolic process
GO:0090208	0.633	positive regulation of triglyceride metabolic process
GO:0046486	0.612	glycerolipid metabolic process
GO:0006796	0.537	phosphate-containing compound metabolic process
GO:0009058	0.527	biosynthetic process
GO:0008610	0.513	lipid biosynthetic process
GO:0019637	0.501	organophosphate metabolic process
GO:0044249	0.466	cellular biosynthetic process
GO:0006650	0.411	glycerophospholipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005829	0.988	cytosol
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0031981	0.970	nuclear lumen
GO:0005811	0.925	lipid droplet
GO:0005654	0.903	nucleoplasm
GO:0016020	0.303	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.888	Hydrolases.
EC:3.1.-.-	0.619	Acting on ester bonds.
EC:3.1.1.-	0.402	Carboxylic ester hydrolases.

[back to server]