StarFunc result for job id Q8WTS6

User Input

>input (366 residues)
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRP
HFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4ADE5	0.998	0.998	1.005E-68	366	0.959	0.959	D4ADE5.pdb.gz	D4ADE5_RAT Histone-lysine N-methyltransferase SETD7 OS=Rattus norvegicus OX=10116 GN=Setd7 PE=3 SV=1
2	AFDB:Q6DHG0	0.979	0.961	1.125E-59	373	0.730	0.716	Q6DHG0.pdb.gz	SETD7_DANRE Histone-lysine N-methyltransferase SETD7 OS=Danio rerio OX=7955 GN=setd7 PE=2 SV=1
3	AFDB:Q8WYR4	0.397	0.464	1.212E-13	309	0.115	0.136	Q8WYR4.pdb.gz	RSPH1_HUMAN Radial spoke head 1 homolog OS=Homo sapiens OX=9606 GN=RSPH1 PE=1 SV=1
4	AFDB:Q8VIG3	0.403	0.482	2.332E-13	301	0.128	0.156	Q8VIG3.pdb.gz	RSPH1_MOUSE Radial spoke head 1 homolog OS=Mus musculus OX=10090 GN=Rsph1 PE=1 SV=2
5	AFDB:Q56YP2	0.375	0.192	1.228E-12	752	0.158	0.077	Q56YP2.pdb.gz	PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PIP5K1 PE=1 SV=1
6	AFDB:Q8L796	0.375	0.193	2.483E-12	754	0.120	0.058	Q8L796.pdb.gz	PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PIP5K2 PE=1 SV=2
7	AFDB:Q587D3	0.382	0.390	6.462E-12	358	0.131	0.134	Q587D3.pdb.gz	Q587D3_TRYB2 MORN repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.330 PE=1 SV=1
8	AFDB:O48709	0.361	0.198	8.311E-12	705	0.126	0.065	O48709.pdb.gz	PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=PIP5K3 PE=4 SV=1
9	AFDB:P72606	0.292	0.302	9.665E-12	349	0.150	0.158	P72606.pdb.gz	P72606_SYNY3 Slr1485 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1485 PE=4 SV=1
10	AFDB:Q9M1K2	0.357	0.178	1.069E-11	779	0.104	0.049	Q9M1K2.pdb.gz	PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana OX=3702 GN=PIP5K4 PE=4 SV=1
11	PDB:7dmpA	0.382	0.705	7.195E-10	186	0.115	0.226	7dmpA.pdb.gz
12	PDB:6wkrC	0.280	0.176	1.117E-6	606	0.096	0.058	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
13	PDB:5hynA	0.280	0.182	1.367E-6	581	0.096	0.060	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
14	PDB:7td5A	0.281	0.210	1.437E-6	497	0.098	0.072	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:7ksoA	0.276	0.257	1.589E-6	395	0.107	0.099	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	PDB:7td5F	0.276	0.228	1.944E-6	447	0.098	0.081	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:6jleA	0.251	0.605	2.377E-6	144	0.082	0.208	6jleA.pdb.gz
18	PDB:5wg6A	0.268	0.194	1.190E-5	517	0.120	0.085	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
19	PDB:5h6zA	0.265	0.709	6.264E-5	123	0.066	0.195	5h6zA.pdb.gz
20	PDB:1pegA	0.269	0.361	8.579E-4	266	0.077	0.105	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0F7	0.0	715	367	0.926	0.924	A0A8I6A0F7_RAT Histone-lysine N-methyltransferase SETD7 OS=Rattus norvegicus OX=10116 GN=Setd7 PE=1 SV=1
2	A0A8I6GI35	0.0	620	342	0.809	0.865	A0A8I6GI35_RAT Histone-lysine N-methyltransferase SETD7 OS=Rattus norvegicus OX=10116 GN=Setd7 PE=1 SV=1
3	D4ADE5	0.0	738	366	0.959	0.959	D4ADE5_RAT Histone-lysine N-methyltransferase SETD7 OS=Rattus norvegicus OX=10116 GN=Setd7 PE=3 SV=1
4	Q6DHG0	0.0	582	373	0.730	0.716	SETD7_DANRE Histone-lysine N-methyltransferase SETD7 OS=Danio rerio OX=7955 GN=setd7 PE=2 SV=1
5	Q8VHL1	0.0	733	366	0.954	0.954	SETD7_MOUSE Histone-lysine N-methyltransferase SETD7 OS=Mus musculus OX=10090 GN=Setd7 PE=1 SV=2
6	Q8WTS6	0.0	760	366	1.000	1.000	SETD7_HUMAN Histone-lysine N-methyltransferase SETD7 OS=Homo sapiens OX=9606 GN=SETD7 PE=1 SV=1
7	Q587D3	1.68e-11	67.0	358	0.131	0.134	Q587D3_TRYB2 MORN repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.330 PE=1 SV=1
8	P72606	5.04e-10	62.4	349	0.123	0.129	P72606_SYNY3 Slr1485 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1485 PE=4 SV=1
9	Q8NDC4	8.03e-09	56.2	146	0.087	0.219	MORN4_HUMAN MORN repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=MORN4 PE=1 SV=1
10	Q384V3	9.62e-09	59.3	653	0.131	0.074	Q384V3_TRYB2 Phosphatidylinositol-4-phosphate 5-kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5030 PE=4 SV=1
11	Q6PGF2	2.19e-08	54.7	146	0.087	0.219	MORN4_MOUSE MORN repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Morn4 PE=1 SV=1
12	O48709	3.62e-08	57.4	705	0.098	0.051	PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=PIP5K3 PE=4 SV=1
13	Q56YP2	1.10e-07	56.2	752	0.098	0.048	PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PIP5K1 PE=1 SV=1
14	Q8VIG3	7.02e-07	52.8	301	0.093	0.113	RSPH1_MOUSE Radial spoke head 1 homolog OS=Mus musculus OX=10090 GN=Rsph1 PE=1 SV=2
15	Q6F6B5	7.15e-07	53.5	741	0.090	0.045	ARC3_ARATH Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ARC3 PE=1 SV=2
16	Q57WF5	1.89e-06	52.0	437	0.156	0.130	Q57WF5_TRYB2 MORN repeat-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.670 PE=4 SV=1
17	Q38AY3	9.66e-06	50.1	690	0.104	0.055	Q38AY3_TRYB2 MORN repeat-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0600 PE=4 SV=1
18	Q57ZM3	1.16e-05	48.9	322	0.093	0.106	Q57ZM3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.280 PE=4 SV=1
19	Q389U2	1.31e-05	49.3	606	0.074	0.045	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1
20	Q8L796	2.30e-05	48.9	754	0.079	0.038	PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PIP5K2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02493 MORN	3.1e-11	53.6	MORN repeat
2	PF00856 SET	0.012	27.5	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006131

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011861	0.956	Cellular tumor antigen p53
2	61853.ENSNLEP00000013539	0.946	SUZ12 polycomb repressive complex 2 subunit
3	61853.ENSNLEP00000019721	0.944	Embryonic ectoderm development
4	61853.ENSNLEP00000019473	0.851	F-box and leucine-rich repeat protein 19
5	61853.ENSNLEP00000015110	0.837	Forkhead box O3
6	61853.ENSNLEP00000018913	0.832	Dpy-30, histone methyltransferase complex regulatory subunit
7	61853.ENSNLEP00000001356	0.820	Forkhead box O1
8	61853.ENSNLEP00000022184	0.816	Belongs to the histone H3 family.
9	61853.ENSNLEP00000001323	0.813	Uncharacterized protein
10	61853.ENSNLEP00000007007	0.804	RELA proto-oncogene, NF-kB subunit
11	61853.ENSNLEP00000003398	0.803	Lysine (K)-specific demethylase 6A
12	61853.ENSNLEP00000014593	0.793	Sirtuin 1
13	61853.ENSNLEP00000014747	0.780	DNA (cytosine-5-)-methyltransferase 1
14	61853.ENSNLEP00000004252	0.758	DDB1 and CUL4 associated factor 10
15	61853.ENSNLEP00000020483	0.749	Uncharacterized protein
16	61853.ENSNLEP00000003167	0.747	Histone deacetylase 1
17	61853.ENSNLEP00000003509	0.744	RB binding protein 4, chromatin remodeling factor
18	61853.ENSNLEP00000011664	0.744	RB binding protein 7, chromatin remodeling factor
19	61853.ENSNLEP00000013762	0.744	WD repeat domain 73
20	61853.ENSNLEP00000015758	0.744	WD repeat domain 59

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.998	catalytic activity, acting on a protein
GO:0016278	0.998	lysine N-methyltransferase activity
GO:0003682	0.996	chromatin binding
GO:0008276	0.932	protein methyltransferase activity
GO:0016279	0.855	protein-lysine N-methyltransferase activity
GO:0042054	0.520	histone methyltransferase activity
GO:0003676	0.314	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0009987	0.968	cellular process
GO:0048518	0.960	positive regulation of biological process
GO:0043170	0.955	macromolecule metabolic process
GO:0050896	0.943	response to stimulus
GO:0008213	0.943	protein alkylation
GO:0009893	0.941	positive regulation of metabolic process
GO:0051173	0.928	positive regulation of nitrogen compound metabolic process
GO:0044237	0.923	cellular metabolic process
GO:0018205	0.920	peptidyl-lysine modification
GO:0032259	0.917	methylation
GO:0018022	0.903	peptidyl-lysine methylation
GO:0048522	0.894	positive regulation of cellular process
GO:0071840	0.890	cellular component organization or biogenesis
GO:0006325	0.881	chromatin organization
GO:0045935	0.876	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.871	positive regulation of DNA-templated transcription
GO:0042221	0.710	response to chemical
GO:0010033	0.676	response to organic substance
GO:0051716	0.675	cellular response to stimulus
GO:0006338	0.652	chromatin remodeling
GO:0045471	0.559	response to ethanol
GO:0006950	0.467	response to stress
GO:0033554	0.408	cellular response to stress
GO:0070828	0.351	heterochromatin organization
GO:0048519	0.332	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.976	nuclear lumen
GO:0005654	0.967	nucleoplasm
GO:0043232	0.934	intracellular non-membrane-bounded organelle
GO:0005694	0.582	chromosome
GO:0032991	0.539	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.
RHEA:51736	0.855	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]