StarFunc result for job id Q8WTT0

User Input

>input (213 residues)
MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLRE
YQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVV
INTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERC
AIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WTT0	1.000	1.000	9.942E-41	213	1.000	1.000	Q8WTT0.pdb.gz	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
2	AFDB:Q9JKF4	0.736	0.749	2.943E-25	209	0.507	0.517	Q9JKF4.pdb.gz	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
3	AFDB:Q6EIG7	0.729	0.742	5.444E-25	209	0.540	0.550	Q6EIG7.pdb.gz	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
4	AFDB:Q7TS58	0.734	0.746	5.099E-24	209	0.507	0.517	Q7TS58.pdb.gz	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
5	AFDB:Q9UMR7	0.698	0.628	9.975E-24	237	0.455	0.409	Q9UMR7.pdb.gz	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
6	AFDB:Q67DU8	0.743	0.760	1.475E-23	208	0.465	0.476	Q67DU8.pdb.gz	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
7	AFDB:Q9QZ15	0.693	0.622	6.614E-22	238	0.413	0.370	Q9QZ15.pdb.gz	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
8	AFDB:Q5YIR8	0.695	0.629	9.251E-22	236	0.399	0.360	Q5YIR8.pdb.gz	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1
9	AFDB:Q8WXI8	0.652	0.646	9.162E-21	215	0.390	0.386	Q8WXI8.pdb.gz	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
10	AFDB:Q9Z2H6	0.681	0.663	9.074E-20	219	0.385	0.374	Q9Z2H6.pdb.gz	CLC4D_MOUSE C-type lectin domain family 4 member D OS=Mus musculus OX=10090 GN=Clec4d PE=1 SV=1
11	PDB:7wz8A	0.536	0.629	7.897E-11	180	0.207	0.244	7wz8A.pdb.gz
12	PDB:1qddA	0.540	0.786	6.993E-10	144	0.141	0.208	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:5f2qB	0.520	0.801	6.549E-9	135	0.150	0.237	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:1htnA	0.546	0.729	4.147E-8	156	0.136	0.186	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
15	PDB:4mthA	0.505	0.751	5.186E-8	139	0.150	0.230	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
16	PDB:2kv3A	0.492	0.757	1.877E-7	131	0.160	0.260	2kv3A.pdb.gz
17	PDB:7qsrA	0.494	0.086	2.936E-7	1335	0.164	0.026	7qsrA.pdb.gz
18	PDB:1gz2A	0.519	0.775	3.284E-7	139	0.131	0.201	1gz2A.pdb.gz
19	PDB:3bx4C	0.428	0.663	1.257E-6	134	0.113	0.179	3bx4C.pdb.gz
20	PDB:1bj3A	0.433	0.694	1.329E-6	129	0.146	0.240	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WTT0	1.80e-161	446	213	1.000	1.000	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
2	Q6EIG7	8.01e-79	236	209	0.540	0.550	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
3	Q9JKF4	2.30e-69	213	209	0.502	0.512	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
4	Q7TS58	1.50e-67	208	209	0.512	0.522	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
5	Q67DU8	2.69e-64	199	208	0.484	0.495	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
6	Q9UMR7	5.43e-64	200	237	0.432	0.388	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
7	Q9D8Q7	1.98e-53	171	176	0.441	0.534	Q9D8Q7_MOUSE C-type lectin domain family 4, member b1 OS=Mus musculus OX=10090 GN=Clec4b1 PE=1 SV=1
8	Q8WXI8	7.48e-53	171	215	0.418	0.414	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
9	Q69FH1	1.54e-51	167	218	0.432	0.422	CLC4D_RAT C-type lectin domain family 4 member D OS=Rattus norvegicus OX=10116 GN=Clec4d PE=1 SV=1
10	Q9QZ15	2.78e-50	165	238	0.380	0.340	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
11	Q9Z2H6	3.60e-50	164	219	0.408	0.397	CLC4D_MOUSE C-type lectin domain family 4 member D OS=Mus musculus OX=10090 GN=Clec4d PE=1 SV=1
12	Q5YIR8	7.00e-49	161	236	0.366	0.331	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1
13	Q67EQ1	1.02e-44	150	215	0.385	0.381	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
14	Q9ULY5	7.19e-43	145	219	0.385	0.374	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
15	Q9R0Q8	1.27e-37	132	214	0.376	0.374	CLC4E_MOUSE C-type lectin domain family 4 member E OS=Mus musculus OX=10090 GN=Clec4e PE=1 SV=1
16	Q91ZX1	2.19e-23	95.5	238	0.258	0.231	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
17	Q91ZW7	2.96e-23	94.7	208	0.230	0.236	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
18	Q91ZW8	4.06e-22	92.4	237	0.254	0.228	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
19	Q9H2X3	7.68e-22	94.0	399	0.263	0.140	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1
20	Q9NNX6	3.60e-21	92.4	404	0.244	0.129	CD209_HUMAN CD209 antigen OS=Homo sapiens OX=9606 GN=CD209 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	7.7e-18	76.6	Lectin C-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440428

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289902	0.947	High affinity immunoglobulin epsilon receptor subunit gamma
2	9606.ENSP00000327890	0.859	Interleukin-3 receptor subunit alpha
3	9606.ENSP00000357152	0.830	T-cell surface glycoprotein CD1c
4	9606.ENSP00000366307	0.751	Thrombomodulin
5	9606.ENSP00000265371	0.740	Neuropilin-1
6	9606.ENSP00000454623	0.717	Integrin alpha-X
7	9606.ENSP00000291759	0.715	Leukocyte immunoglobulin-like receptor subfamily A member 4
8	9606.ENSP00000266041	0.710	Inter-alpha-trypsin inhibitor heavy chain H4
9	9606.ENSP00000353874	0.710	Toll-like receptor 9
10	9606.ENSP00000370034	0.685	Toll-like receptor 7
11	9606.ENSP00000276927	0.682	Interferon alpha-1/13
12	9606.ENSP00000437940	0.681	B-lymphocyte antigen CD19
13	9606.ENSP00000480132	0.681	Neural cell adhesion molecule 1
14	9606.ENSP00000417517	0.674	annotation not available
15	9606.ENSP00000011653	0.660	T-cell surface glycoprotein CD4
16	9606.ENSP00000364907	0.638	Tyrosine-protein kinase SYK
17	9606.ENSP00000356946	0.631	Low affinity immunoglobulin gamma Fc region receptor III-A
18	9606.ENSP00000368450	0.631	CD83 antigen
19	9606.ENSP00000332049	0.630	T-lymphocyte activation antigen CD86
20	9606.ENSP00000433642	0.622	Low affinity immunoglobulin gamma Fc region receptor III-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.922	carbohydrate binding
GO:0038023	0.632	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.952	cellular process
GO:0048518	0.929	positive regulation of biological process
GO:0048522	0.859	positive regulation of cellular process
GO:0051716	0.819	cellular response to stimulus
GO:0002682	0.814	regulation of immune system process
GO:0007165	0.789	signal transduction
GO:0002376	0.754	immune system process
GO:0051239	0.714	regulation of multicellular organismal process
GO:0019222	0.714	regulation of metabolic process
GO:0048583	0.703	regulation of response to stimulus
GO:0060255	0.668	regulation of macromolecule metabolic process
GO:0009893	0.542	positive regulation of metabolic process
GO:0010468	0.526	regulation of gene expression
GO:0006955	0.480	immune response
GO:0002684	0.480	positive regulation of immune system process
GO:0010604	0.479	positive regulation of macromolecule metabolic process
GO:0001817	0.477	regulation of cytokine production
GO:0009605	0.454	response to external stimulus
GO:0048584	0.438	positive regulation of response to stimulus
GO:0032501	0.433	multicellular organismal process
GO:0006952	0.429	defense response
GO:0007166	0.389	cell surface receptor signaling pathway
GO:0051240	0.382	positive regulation of multicellular organismal process
GO:0050776	0.344	regulation of immune response
GO:0009607	0.328	response to biotic stimulus
GO:0044419	0.327	biological process involved in interspecies interaction between organisms
GO:0051707	0.300	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.965	membrane-bounded organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0012505	0.928	endomembrane system
GO:0005737	0.924	cytoplasm
GO:0031982	0.901	vesicle
GO:0031410	0.845	cytoplasmic vesicle
GO:0031090	0.838	organelle membrane
GO:0098588	0.746	bounding membrane of organelle
GO:0030659	0.666	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]