StarFunc result for job id Q8WTU0

User Input

>input (396 residues)
MLITVYCVRRDLSEVTFSLQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCS
LGSYGLKDGDIVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTP
AAQRSQGLASGEKVAGLQGLGSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFS
QVLMEQQREKALREQERLRLYTADPLDREAQAKIEEEIRQQNIEENMNIAIEEAPESFGQ
VTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIG
RVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYF
LPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WTU0	1.000	1.000	1.240E-76	396	1.000	1.000	Q8WTU0.pdb.gz	DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens OX=9606 GN=DDI1 PE=1 SV=1
2	AFDB:Q5TDH0	0.545	0.541	8.966E-60	399	0.707	0.702	Q5TDH0.pdb.gz	DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1
3	AFDB:Q9VXF9	0.547	0.476	4.360E-46	458	0.477	0.413	Q9VXF9.pdb.gz	Q9VXF9_DROME AT13091p OS=Drosophila melanogaster OX=7227 GN=rngo PE=1 SV=1
4	AFDB:Q1EBV4	0.467	0.447	7.953E-37	414	0.326	0.312	Q1EBV4.pdb.gz	DDI1_ARATH Protein DNA-DAMAGE INDUCIBLE 1 OS=Arabidopsis thaliana OX=3702 GN=DDI1 PE=1 SV=1
5	AFDB:P40087	0.427	0.400	1.086E-28	428	0.298	0.276	P40087.pdb.gz	DDI1_YEAST DNA damage-inducible protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DDI1 PE=1 SV=1
6	AFDB:Q38FA2	0.442	0.462	5.965E-27	378	0.263	0.275	Q38FA2.pdb.gz	Q38FA2_TRYB2 DNA-damage inducible protein DDI1-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2990 PE=3 SV=1
7	AFDB:Q10256	0.424	0.501	2.440E-25	332	0.258	0.307	Q10256.pdb.gz	MUD1_SCHPO UBA domain-containing protein Mud1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mud1 PE=1 SV=1
8	AFDB:Q17569	0.449	0.457	4.397E-25	389	0.268	0.272	Q17569.pdb.gz	DDI1_CAEEL Protein DDI1 homolog 1 OS=Caenorhabditis elegans OX=6239 GN=ddi-1 PE=1 SV=2
9	AFDB:Q9NQ35	0.286	0.459	1.055E-11	241	0.106	0.174	Q9NQ35.pdb.gz	NRIP3_HUMAN Nuclear receptor-interacting protein 3 OS=Homo sapiens OX=9606 GN=NRIP3 PE=1 SV=1
10	AFDB:Q9BQI9	0.276	0.381	1.258E-11	281	0.162	0.228	Q9BQI9.pdb.gz	NRIP2_HUMAN Nuclear receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=NRIP2 PE=1 SV=3
11	PDB:4pyuA	0.168	0.733	2.595E-6	76	0.048	0.250	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
12	PDB:6yvaC	0.179	0.421	1.611E-5	155	0.040	0.103	6yvaC.pdb.gz
13	PDB:2avoA	0.205	0.712	2.434E-5	99	0.056	0.222	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.
14	PDB:5xqmA	0.165	0.572	2.434E-5	90	0.043	0.189	5xqmA.pdb.gz
15	PDB:7rbsB	0.174	0.406	4.135E-5	157	0.038	0.096	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
16	PDB:3dbhI	0.171	0.657	5.889E-5	86	0.028	0.128	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
17	PDB:3plvA	0.161	0.675	7.027E-5	80	0.038	0.188	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
18	PDB:3ai5A	0.161	0.209	1.001E-4	299	0.033	0.043	3ai5A.pdb.gz
19	PDB:6mdhA	0.166	0.402	1.126E-4	149	0.025	0.067	6mdhA.pdb.gz
20	PDB:1qzeA	0.166	0.293	1.425E-4	214	0.088	0.164	1qzeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TDH0	0.0	581	399	0.717	0.712	DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1
2	Q8WTU0	0.0	812	396	1.000	1.000	DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens OX=9606 GN=DDI1 PE=1 SV=1
3	Q9VXF9	1.10e-108	328	458	0.472	0.408	Q9VXF9_DROME AT13091p OS=Drosophila melanogaster OX=7227 GN=rngo PE=1 SV=1
4	Q1EBV4	9.12e-67	219	414	0.341	0.326	DDI1_ARATH Protein DNA-DAMAGE INDUCIBLE 1 OS=Arabidopsis thaliana OX=3702 GN=DDI1 PE=1 SV=1
5	Q10256	2.11e-54	184	332	0.263	0.313	MUD1_SCHPO UBA domain-containing protein Mud1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mud1 PE=1 SV=1
6	P40087	6.14e-48	170	428	0.215	0.199	DDI1_YEAST DNA damage-inducible protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DDI1 PE=1 SV=1
7	Q17569	1.38e-39	147	389	0.220	0.224	DDI1_CAEEL Protein DDI1 homolog 1 OS=Caenorhabditis elegans OX=6239 GN=ddi-1 PE=1 SV=2
8	Q38FA2	6.73e-39	145	378	0.179	0.188	Q38FA2_TRYB2 DNA-damage inducible protein DDI1-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2990 PE=3 SV=1
9	Q9NQ35	5.13e-08	55.8	241	0.096	0.158	NRIP3_HUMAN Nuclear receptor-interacting protein 3 OS=Homo sapiens OX=9606 GN=NRIP3 PE=1 SV=1
10	Q9BQI9	1.81e-07	54.3	281	0.093	0.132	NRIP2_HUMAN Nuclear receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=NRIP2 PE=1 SV=3
11	Q9SII9	0.007	40.8	538	0.136	0.100	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
12	A1Z651	0.039	38.9	1733	0.088	0.020	POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) OX=373193 GN=gag-pol PE=1 SV=1
13	Q9JHR9	0.061	37.4	270	0.071	0.104	NRIP2_MOUSE Nuclear receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Nrip2 PE=1 SV=2
14	Q09PK2	0.10	37.0	339	0.078	0.091	APRV1_MOUSE Retroviral-like aspartic protease 1 OS=Mus musculus OX=10090 GN=Asprv1 PE=1 SV=1
15	Q9SII8	0.20	36.2	551	0.048	0.034	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
16	P54725	0.65	34.3	363	0.088	0.096	RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1
17	Q8IYU4	0.78	34.3	475	0.048	0.040	UBQLN_HUMAN Ubiquilin-like protein OS=Homo sapiens OX=9606 GN=UBQLNL PE=1 SV=3
18	Q8IDX6	1.5	33.9	3130	0.035	0.004	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
19	Q53RT3	1.9	32.7	343	0.078	0.090	APRV1_HUMAN Retroviral-like aspartic protease 1 OS=Homo sapiens OX=9606 GN=ASPRV1 PE=1 SV=1
20	Q583M0	2.4	30.8	95	0.043	0.179	Q583M0_TRYB2 Ubiquitin-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.920 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09668 Asp_protease	1e-57	204.7	Aspartyl protease
2	PF13650 Asp_protease_2	9.9e-06	37.5	Aspartyl protease
3	PF13975 gag-asp_proteas	2.9e-21	87.1	gag-polyprotein putative aspartyl protease
4	PF00077 RVP	0.11	24.2	Retroviral aspartyl protease
5	PF08284 RVP_2	0.061	24.6	Retroviral aspartyl protease
6	PF05157 T2SSE_N	2.2e+02	13.4	Type II secretion system (T2SS), protein E, N-terminal domain
7	PF00240 ubiquitin	3.7e-05	34.7	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467024	0.930	UV excision repair protein RAD23 homolog A
2	9606.ENSP00000357879	0.897	26S proteasome non-ATPase regulatory subunit 4
3	9606.ENSP00000365576	0.897	Ubiquilin-1
4	9606.ENSP00000478877	0.895	Proteasomal ubiquitin receptor ADRM1
5	9606.ENSP00000345195	0.871	Ubiquilin-2
6	9606.ENSP00000350708	0.857	UV excision repair protein RAD23 homolog B
7	9606.ENSP00000386541	0.805	26S proteasome non-ATPase regulatory subunit 14
8	9606.ENSP00000286091	0.801	Protein disulfide-isomerase A4
9	9606.ENSP00000354416	0.768	C-C motif chemokine 28
10	9606.ENSP00000263918	0.732	Striatin
11	9606.ENSP00000350071	0.732	Striatin-3
12	9606.ENSP00000441543	0.710	Polyubiquitin-C
13	9606.ENSP00000215071	0.699	26S proteasome non-ATPase regulatory subunit 8
14	9606.ENSP00000261601	0.692	Ubiquitin carboxyl-terminal hydrolase 14
15	9606.ENSP00000357292	0.679	Ubiquilin-4
16	9606.ENSP00000157812	0.673	26S proteasome regulatory subunit 6B
17	9606.ENSP00000310129	0.673	26S proteasome non-ATPase regulatory subunit 2
18	9606.ENSP00000331487	0.654	Nuclear protein localization protein 4 homolog
19	9606.ENSP00000347997	0.647	Ubiquilin-3
20	9606.ENSP00000264639	0.644	26S proteasome non-ATPase regulatory subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.588	catalytic activity
GO:0140096	0.571	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0051603	0.993	proteolysis involved in protein catabolic process
GO:0051716	0.992	cellular response to stimulus
GO:0010035	0.989	response to inorganic substance
GO:0065007	0.988	biological regulation
GO:0010498	0.980	proteasomal protein catabolic process
GO:0031647	0.978	regulation of protein stability
GO:0071241	0.963	cellular response to inorganic substance
GO:1901698	0.961	response to nitrogen compound
GO:0010033	0.941	response to organic substance
GO:0050789	0.655	regulation of biological process
GO:1901699	0.628	cellular response to nitrogen compound
GO:0044237	0.483	cellular metabolic process
GO:0050794	0.419	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.998	cytoplasm
GO:0005829	0.983	cytosol
GO:0005654	0.979	nucleoplasm
GO:0016020	0.692	membrane
GO:0032991	0.521	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]