StarFunc result for job id Q8WTW3

User Input

>input (980 residues)
MATAATSPALKRLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLI
EAADTIGQMRRCAVGLVDAVKATDQYCARLRQAGSAAPRPPRAQQPQQPSQEKFYSMAAQ
IKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSSSSRYSPVLSRFPILIRQV
AAASHFRSTILHESKMLLKCQGVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQK
LLNQPHHGAGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITG
QHPAGKGTGVLQEEMKLCSWFKHLPASIVEFQPTLRTLAHPISQEYLKDTLQKWIHMCNE
DIKNGITNLLMYVKSMKGLAGIRDAMWELLTNESTNHSWDVLCRRLLEKPLLFWEDMMQQ
LFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESP
NDLPSDAAWVSVANRGQFASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDD
SSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQ
DALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPAREFRALRKQGKVKTQEI
IPTQAKWQEVKEVLLQQSVMGYQVWSSAVVKVLIHGFTQSLLLDDAGSVLATATSWDELE
IQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQV
VAAYEKLSEEKQIKKEGAFPVTQNRALQLLYDLRYLNIVLTAKGDEVKSGRSKPDSRIEK
VTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQLAPRSSTFNSQEPHN
ILPLASSQIRFGLLPLSMTSTRKAKSTRNIETKAQVVPPARSTAGDPTVPGSLFRQLVSE
EDNTSAPSLFKLGWLSSMTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WTW3	1.000	1.000	0.000	980	1.000	1.000	Q8WTW3.pdb.gz	COG1_HUMAN Conserved oligomeric Golgi complex subunit 1 OS=Homo sapiens OX=9606 GN=COG1 PE=1 SV=1
2	AFDB:Q9VGC3	0.628	0.690	5.246E-33	886	0.231	0.255	Q9VGC3.pdb.gz	COG1_DROME Conserved oligomeric Golgi complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cog1 PE=1 SV=1
3	AFDB:Q9FFF3	0.538	0.500	4.251E-31	1068	0.231	0.212	Q9FFF3.pdb.gz	COG1_ARATH Conserved oligomeric Golgi complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=COG1 PE=1 SV=1
4	AFDB:G5EE66	0.462	0.556	2.990E-19	787	0.165	0.206	G5EE66.pdb.gz	G5EE66_CAEEL Conserved oligomeric Golgi complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=cogc-1 PE=1 SV=1
5	AFDB:F4K7F5	0.262	0.300	8.133E-8	814	0.107	0.129	F4K7F5.pdb.gz	F4K7F5_ARATH Exocyst complex component 84B OS=Arabidopsis thaliana OX=3702 GN=EXO84B PE=1 SV=1
6	AFDB:O01839	0.296	0.378	1.031E-7	700	0.092	0.129	O01839.pdb.gz	VPS51_CAEEL Vacuolar protein sorting-associated protein 51 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-51 PE=1 SV=2
7	AFDB:Q0WQ75	0.256	0.297	1.594E-7	780	0.111	0.140	Q0WQ75.pdb.gz	VPS51_ARATH Vacuolar protein sorting-associated protein 51 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS51 PE=1 SV=1
8	AFDB:Q0WQF4	0.202	0.229	4.290E-7	828	0.101	0.120	Q0WQF4.pdb.gz	VP53A_ARATH Vacuolar protein sorting-associated protein 53 A OS=Arabidopsis thaliana OX=3702 GN=VPS53 PE=1 SV=1
9	AFDB:Q9VLC0	0.275	0.284	6.373E-7	940	0.106	0.111	Q9VLC0.pdb.gz	VPS54_DROME Vacuolar protein sorting-associated protein 54 OS=Drosophila melanogaster OX=7227 GN=scat PE=1 SV=1
10	AFDB:Q155U0	0.310	0.355	8.409E-7	827	0.116	0.138	Q155U0.pdb.gz	VPS51_DANRE Vacuolar protein sorting-associated protein 51 homolog OS=Danio rerio OX=7955 GN=vps51 PE=2 SV=1
11	PDB:7qpgW	0.166	0.196	6.192E-4	779	0.086	0.108	7qpgW.pdb.gz
12	PDB:5yfpC	0.204	0.235	1.036E-3	794	0.090	0.111	5yfpC.pdb.gz
13	PDB:2xwuB	0.089	0.093	1.666E-3	910	0.088	0.095	2xwuB.pdb.gz
14	PDB:3icqT	0.083	0.085	1.733E-3	949	0.091	0.094	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
15	PDB:7unkA	0.076	0.073	1.876E-3	1047	0.122	0.115	7unkA.pdb.gz
16	PDB:1qgkA	0.082	0.089	2.475E-3	876	0.088	0.098	1qgkA.pdb.gz
17	PDB:6q82A	0.075	0.072	3.535E-3	1027	0.100	0.095	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
18	PDB:3w3zA	0.080	0.078	4.483E-3	1013	0.097	0.094	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
19	PDB:7r5jB0	0.096	0.067	5.464E-3	1748	0.111	0.062	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:4r0zA	0.108	0.153	7.500E-3	557	0.071	0.126	4r0zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WTW3	0.0	2016	980	1.000	1.000	COG1_HUMAN Conserved oligomeric Golgi complex subunit 1 OS=Homo sapiens OX=9606 GN=COG1 PE=1 SV=1
2	Q9FFF3	9.00e-47	184	1068	0.249	0.228	COG1_ARATH Conserved oligomeric Golgi complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=COG1 PE=1 SV=1
3	Q9VGC3	3.56e-39	159	886	0.240	0.265	COG1_DROME Conserved oligomeric Golgi complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cog1 PE=1 SV=1
4	G5EE66	0.007	42.7	787	0.018	0.023	G5EE66_CAEEL Conserved oligomeric Golgi complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=cogc-1 PE=1 SV=1
5	Q9UTL1	0.18	38.1	701	0.018	0.026	COG1_SCHPO Conserved oligomeric Golgi complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cog1 PE=3 SV=1
6	A0A8L2R539	2.3	32.7	140	0.023	0.164	A0A8L2R539_RAT Mannosidase, alpha, class 2B, member 2 OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=1
7	Q7TP34	2.8	34.3	1449	0.023	0.016	Q7TP34_RAT Ab2-450 OS=Rattus norvegicus OX=10116 GN=Man2b2 PE=1 SV=1
8	E1C8P7	3.4	34.3	2042	0.030	0.014	DSCL1_CHICK Cell adhesion molecule DSCAML1 OS=Gallus gallus OX=9031 GN=DSCAML1 PE=1 SV=2
9	P13036	3.7	33.9	774	0.015	0.019	FECA_ECOLI Fe(3+) dicitrate transport protein FecA OS=Escherichia coli (strain K12) OX=83333 GN=fecA PE=1 SV=2
10	P52917	3.9	33.5	437	0.021	0.048	VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS4 PE=1 SV=1
11	Q5M820	6.1	31.6	125	0.024	0.192	MOFA1_RAT MORF4 family-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Mrfap1 PE=1 SV=1
12	Q8TD84	8.1	32.7	2053	0.026	0.012	DSCL1_HUMAN Cell adhesion molecule DSCAML1 OS=Homo sapiens OX=9606 GN=DSCAML1 PE=1 SV=2
13	Q4VA61	8.8	32.7	2053	0.026	0.012	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
14	Q586L0	9.6	32.7	1399	0.013	0.009	Q586L0_TRYB2 Conserved oligomeric Golgi complex subunit 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.80 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12022 COG2_C	4	19.1	COG complex component, COG2, C-terminal
2	PF08700 Vps51	6e-10	50.4	Vps51/Vps67

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258654	0.999	Conserved oligomeric Golgi complex subunit 3
2	9606.ENSP00000297135	0.999	Conserved oligomeric Golgi complex subunit 5
3	9606.ENSP00000305442	0.999	Conserved oligomeric Golgi complex subunit 7
4	9606.ENSP00000305459	0.999	Conserved oligomeric Golgi complex subunit 8
5	9606.ENSP00000315775	0.999	Conserved oligomeric Golgi complex subunit 4
6	9606.ENSP00000355629	0.999	Conserved oligomeric Golgi complex subunit 2
7	9606.ENSP00000397441	0.999	Conserved oligomeric Golgi complex subunit 6
8	9606.ENSP00000457718	0.988	Conserved oligomeric Golgi complex subunit 8
9	9606.ENSP00000306496	0.915	Ras-related protein Rab-33B
10	9606.ENSP00000319781	0.909	Ras-related protein Rab-43
11	9606.ENSP00000204726	0.902	Golgin subfamily A member 3
12	9606.ENSP00000279281	0.881	Vacuolar protein sorting-associated protein 51 homolog
13	9606.ENSP00000225724	0.850	Golgi SNAP receptor complex member 1
14	9606.ENSP00000294179	0.850	Syntaxin-5
15	9606.ENSP00000225567	0.838	Golgi SNAP receptor complex member 2
16	9606.ENSP00000454500	0.838	Uncharacterized protein
17	9606.ENSP00000401435	0.835	Vacuolar protein sorting-associated protein 53 homolog
18	9606.ENSP00000416097	0.831	Golgin subfamily A member 2
19	9606.ENSP00000249923	0.826	Coatomer subunit beta
20	9606.ENSP00000360183	0.825	Syntaxin-16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006810	0.979	transport
GO:0016192	0.944	vesicle-mediated transport
GO:0008152	0.905	metabolic process
GO:0016043	0.875	cellular component organization
GO:0048193	0.875	Golgi vesicle transport
GO:0006891	0.785	intra-Golgi vesicle-mediated transport
GO:0070085	0.768	glycosylation
GO:0006996	0.733	organelle organization
GO:0007030	0.681	Golgi organization
GO:0065007	0.367	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0017119	0.998	Golgi transport complex
GO:0000139	0.997	Golgi membrane
GO:0032588	0.996	trans-Golgi network membrane
GO:0005829	0.886	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]