StarFunc result for job id Q8WTW4

User Input

>input (380 residues)
MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM
EKKLIGCPVCIEHKKYSRNALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELESSFVS
MEESKQKLVPIMTILLEELNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKD
KEDFFNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQ
YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGR
HPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGM
SYHELDERLENDPNIIICWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WTW4	1.000	1.000	1.162E-78	380	1.000	1.000	Q8WTW4.pdb.gz	NPRL2_HUMAN GATOR1 complex protein NPRL2 OS=Homo sapiens OX=9606 GN=NPRL2 PE=1 SV=2
2	PDB:7t3cB	0.826	0.863	6.096E-53	362	0.942	0.989	7t3cB.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
3	AFDB:Q9VXA0	0.862	0.801	2.926E-49	412	0.445	0.410	Q9VXA0.pdb.gz	NPRL2_DROME GATOR complex protein NPRL2 OS=Drosophila melanogaster OX=7227 GN=Nprl2 PE=1 SV=1
4	AFDB:O42857	0.881	0.824	1.804E-41	409	0.300	0.279	O42857.pdb.gz	NPR2_SCHPO Nitrogen permease regulator 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.03c PE=3 SV=1
5	PDB:6cesN	0.539	0.628	2.857E-34	321	0.729	0.863	6cesN.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
6	AFDB:P39923	0.854	0.543	6.387E-32	615	0.311	0.192	P39923.pdb.gz	NPR2_YEAST Nitrogen permease regulator 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPR2 PE=1 SV=2
7	AFDB:Q12980	0.609	0.443	1.492E-18	569	0.174	0.116	Q12980.pdb.gz	NPRL3_HUMAN GATOR1 complex protein NPRL3 OS=Homo sapiens OX=9606 GN=NPRL3 PE=1 SV=1
8	AFDB:Q9VUB4	0.543	0.372	2.512E-18	610	0.163	0.102	Q9VUB4.pdb.gz	NPRL3_DROME GATOR complex protein NPRL3 OS=Drosophila melanogaster OX=7227 GN=Nprl3 PE=1 SV=1
9	PDB:7t3aC	0.507	0.483	6.847E-14	406	0.158	0.148	7t3aC.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
10	AFDB:Q9HGM7	0.521	0.376	2.516E-13	585	0.195	0.126	Q9HGM7.pdb.gz	NPRL3_SCHPO Nitrogen permease regulator 3-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.04 PE=3 SV=1
11	AFDB:Q57YB1	0.413	0.238	4.003E-8	746	0.155	0.079	Q57YB1.pdb.gz	Q57YB1_TRYB2 Nitrogen permease regulator 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.390 PE=3 SV=1
12	AFDB:P38742	0.414	0.169	1.430E-7	1146	0.150	0.050	P38742.pdb.gz	NPR3_YEAST Nitrogen permease regulator 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPR3 PE=1 SV=1
13	AFDB:O42907	0.242	0.209	2.465E-5	448	0.050	0.042	O42907.pdb.gz	YBAG_SCHPO Uncharacterized protein C119.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.16c PE=4 SV=1
14	PDB:4lgwA	0.194	0.288	4.129E-3	238	0.066	0.105	4lgwA.pdb.gz
15	PDB:6cbqA	0.177	0.267	9.834E-3	234	0.076	0.124	6cbqA.pdb.gz	Mechanism of agonism and antagonism of the Pseudomonas aeruginosa quorum sensing regulator QscR with non-native ligands.
16	PDB:7p3xS	0.230	0.457	1.859E-2	168	0.066	0.149	7p3xS.pdb.gz
17	PDB:6lt0C	0.238	0.236	2.343E-2	385	0.034	0.034	6lt0C.pdb.gz
18	PDB:6ulgN	0.227	0.187	3.722E-2	483	0.029	0.023	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
19	PDB:7o2wA	0.251	0.231	4.427E-2	418	0.055	0.050	7o2wA.pdb.gz
20	PDB:7q3eB	0.252	0.198	5.912E-2	503	0.053	0.040	7q3eB.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WTW4	0.0	788	380	1.000	1.000	NPRL2_HUMAN GATOR1 complex protein NPRL2 OS=Homo sapiens OX=9606 GN=NPRL2 PE=1 SV=2
2	Q9VXA0	8.37e-111	332	412	0.455	0.420	NPRL2_DROME GATOR complex protein NPRL2 OS=Drosophila melanogaster OX=7227 GN=Nprl2 PE=1 SV=1
3	O42857	7.76e-64	211	409	0.300	0.279	NPR2_SCHPO Nitrogen permease regulator 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.03c PE=3 SV=1
4	P39923	1.04e-19	93.2	615	0.126	0.078	NPR2_YEAST Nitrogen permease regulator 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPR2 PE=1 SV=2
5	E9QGU5	0.78	34.3	412	0.079	0.073	E9QGU5_DANRE Voltage-gated potassium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:171453 PE=3 SV=1
6	Q4GZ31	1.2	33.9	1443	0.055	0.015	Q4GZ31_TRYB2 WD repeat protein mio zinc-ribbon like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1880 PE=4 SV=1
7	A0A0E1R8M9	4.4	32.0	1530	0.058	0.014	A0A0E1R8M9_LISMN Glutamate synthase [NADPH] large chain OS=Listeria monocytogenes serotype 4b str. LL195 OX=1230340 GN=gltA PE=3 SV=1
8	R9UTQ8	6.2	31.2	268	0.055	0.078	PROHY_STRGD L-proline trans-4-hydroxylase OS=Streptomyces griseoviridis OX=45398 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06218 NPR2	1.6e-85	299.1	Nitrogen permease regulator 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232501

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369899	0.999	Ras-related GTP-binding protein A
2	9606.ENSP00000383105	0.999	GATOR complex protein DEPDC5
3	9606.ENSP00000483814	0.999	GATOR complex protein NPRL3
4	9606.ENSP00000262144	0.998	GATOR complex protein WDR59
5	9606.ENSP00000339881	0.998	GATOR complex protein MIOS
6	9606.ENSP00000293883	0.997	GATOR complex protein WDR24
7	9606.ENSP00000362092	0.997	Ras-related GTP-binding protein C
8	9606.ENSP00000382779	0.996	Nucleoporin SEH1
9	9606.ENSP00000262850	0.994	Ras-related GTP-binding protein B
10	9606.ENSP00000373312	0.990	Protein SEC13 homolog
11	9606.ENSP00000358423	0.987	Ras-related GTP-binding protein D
12	9606.ENSP00000354558	0.984	Serine/threonine-protein kinase mTOR
13	9606.ENSP00000307272	0.979	Regulatory-associated protein of mTOR
14	9606.ENSP00000262187	0.971	GTP-binding protein Rheb
15	9606.ENSP00000343118	0.966	Ragulator complex protein LAMTOR4
16	9606.ENSP00000456405	0.965	Target of rapamycin complex subunit LST8
17	9606.ENSP00000256644	0.960	Ragulator complex protein LAMTOR5
18	9606.ENSP00000357288	0.960	Ragulator complex protein LAMTOR2
19	9606.ENSP00000424183	0.957	Ragulator complex protein LAMTOR3
20	9606.ENSP00000278671	0.955	Ragulator complex protein LAMTOR1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0004672	1.000	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.995	cellular response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0034198	0.989	cellular response to amino acid starvation
GO:0048583	0.978	regulation of response to stimulus
GO:0009966	0.967	regulation of signal transduction
GO:0031323	0.960	regulation of cellular metabolic process
GO:0032006	0.958	regulation of TOR signaling
GO:0031324	0.936	negative regulation of cellular metabolic process
GO:0051174	0.924	regulation of phosphorus metabolic process
GO:0032007	0.896	negative regulation of TOR signaling
GO:0019220	0.891	regulation of phosphate metabolic process
GO:0042325	0.793	regulation of phosphorylation
GO:0050790	0.765	regulation of catalytic activity
GO:0051338	0.725	regulation of transferase activity
GO:0010563	0.699	negative regulation of phosphorus metabolic process
GO:0043549	0.688	regulation of kinase activity
GO:0045936	0.674	negative regulation of phosphate metabolic process
GO:0044092	0.629	negative regulation of molecular function
GO:0042326	0.526	negative regulation of phosphorylation
GO:0033673	0.511	negative regulation of kinase activity
GO:0048518	0.407	positive regulation of biological process
GO:0048522	0.320	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035859	0.999	Seh1-associated complex
GO:0005765	0.999	lysosomal membrane
GO:0005829	0.919	cytosol
GO:1990130	0.762	GATOR1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]