StarFunc result for job id Q8WTX7

User Input

>input (329 residues)
MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGF
KELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQT
DFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSP
QNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIV
MDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYIST
FNFDHALVPEDGIGSVIEVLQRRQEGLAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WTX7	1.000	1.000	1.540E-69	329	1.000	1.000	Q8WTX7.pdb.gz	CAST1_HUMAN Cytosolic arginine sensor for mTORC1 subunit 1 OS=Homo sapiens OX=9606 GN=CASTOR1 PE=1 SV=1
2	PDB:5gt7C	0.888	0.918	8.975E-57	318	0.957	0.991	5gt7C.pdb.gz	Crystal structures of arginine sensor CASTOR1 in arginine-bound and ligand free states
3	PDB:5gv2C	0.879	0.941	7.051E-56	307	0.900	0.964	5gv2C.pdb.gz	Structural mechanism for the arginine sensing and regulation of CASTOR1 in the mTORC1 signaling pathway
4	AFDB:A6NHX0	0.931	0.931	1.717E-50	329	0.632	0.632	A6NHX0.pdb.gz	CAST2_HUMAN Cytosolic arginine sensor for mTORC1 subunit 2 OS=Homo sapiens OX=9606 GN=CASTOR2 PE=1 SV=3
5	PDB:5gt8B	0.804	0.978	5.696E-48	270	0.815	0.993	5gt8B.pdb.gz
6	AFDB:Q8LJW1	0.315	0.245	4.566E-4	449	0.131	0.096	Q8LJW1.pdb.gz	ACR7_ARATH ACT domain-containing protein ACR7 OS=Arabidopsis thaliana OX=3702 GN=ACR7 PE=2 SV=1
7	AFDB:F4I0I7	0.303	0.234	1.078E-3	455	0.128	0.092	F4I0I7.pdb.gz	F4I0I7_ARATH ACT domain-containing protein ACR OS=Arabidopsis thaliana OX=3702 GN=ACR4 PE=1 SV=1
8	AFDB:O23653	0.281	0.182	2.402E-3	544	0.061	0.037	O23653.pdb.gz	AK2_ARATH Aspartokinase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AK2 PE=1 SV=2
9	AFDB:A4VFY3	0.267	0.194	2.694E-3	476	0.085	0.059	A4VFY3.pdb.gz	AKECT_STUS1 Aspartate kinase Ask_Ect OS=Stutzerimonas stutzeri (strain A1501) OX=379731 GN=ask PE=1 SV=2
10	AFDB:Q6ZSC3	0.165	0.155	3.021E-3	357	0.112	0.104	Q6ZSC3.pdb.gz	RBM43_HUMAN RNA-binding protein 43 OS=Homo sapiens OX=9606 GN=RBM43 PE=1 SV=1
11	PDB:2j0wA	0.262	0.202	4.879E-3	447	0.076	0.056	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.
12	AFDB:P9WN29	0.228	0.108	5.057E-3	808	0.116	0.047	P9WN29.pdb.gz	GLND_MYCTU Bifunctional uridylyltransferase/uridylyl-removing enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glnD PE=1 SV=1
13	AFDB:Q59229	0.283	0.232	6.359E-3	411	0.088	0.071	Q59229.pdb.gz	AK_BACSG Aspartokinase OS=Bacillus sp. (strain MGA3) OX=126782 GN=lysC PE=1 SV=1
14	AFDB:P10869	0.252	0.169	8.467E-3	527	0.058	0.036	P10869.pdb.gz	AK_YEAST Aspartokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOM3 PE=1 SV=2
15	PDB:6ahrL	0.101	0.095	9.160E-3	362	0.128	0.116	6ahrL.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
16	PDB:2v50D	0.158	0.071	1.368E-2	998	0.103	0.034	2v50D.pdb.gz
17	PDB:1nrkA	0.224	0.226	1.928E-2	325	0.052	0.052	1nrkA.pdb.gz
18	PDB:4pabB	0.209	0.101	6.417E-2	824	0.128	0.051	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
19	PDB:1wsvA	0.219	0.199	1.074E-1	371	0.036	0.032	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
20	PDB:6bajA	0.144	0.071	1.205E-1	995	0.094	0.031	6bajA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WTX7	0.0	670	329	1.000	1.000	CAST1_HUMAN Cytosolic arginine sensor for mTORC1 subunit 1 OS=Homo sapiens OX=9606 GN=CASTOR1 PE=1 SV=1
2	A6NHX0	2.93e-145	414	329	0.629	0.629	CAST2_HUMAN Cytosolic arginine sensor for mTORC1 subunit 2 OS=Homo sapiens OX=9606 GN=CASTOR2 PE=1 SV=3
3	Q8LRC7	1.1	33.5	680	0.055	0.026	Q8LRC7_ORYSJ RING-type E3 ubiquitin transferase OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0823900 PE=2 SV=1
4	Q3SAU9	5.1	31.2	442	0.076	0.057	Q3SAU9_ONCMY Tapasin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
5	A1XQX4	5.6	31.6	1670	0.036	0.007	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
6	Q3SAU8	9.3	30.4	442	0.076	0.057	Q3SAU8_ONCMY Tapasin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01842 ACT	24	16.1	ACT domain
2	PF13840 ACT_7	2.3e-34	128.3	ACT domain
3	PF18700 Castor1_N	2.6e-33	125.0	Cytosolic arginine sensor for mTORC1 subunit 1 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004308

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015758	0.960	WD repeat domain 59
2	61853.ENSNLEP00000019574	0.956	Missing oocyte, meiosis regulator, homolog (Drosophila)
3	61853.ENSNLEP00000011097	0.932	SEH1-like (S. cerevisiae)
4	61853.ENSNLEP00000005468	0.907	SEC13 homolog, nuclear pore and COPII coat complex component
5	61853.ENSNLEP00000002484	0.854	Zinc finger, C2HC-type containing 1A
6	61853.ENSNLEP00000022844	0.806	Ras-related GTP binding A
7	61853.ENSNLEP00000014355	0.795	annotation not available
8	61853.ENSNLEP00000020737	0.767	Chromosome 12 open reading frame 66
9	61853.ENSNLEP00000015968	0.761	Ras-related GTP binding D
10	61853.ENSNLEP00000005480	0.745	Ras homolog enriched in brain
11	61853.ENSNLEP00000001755	0.741	V-type proton ATPase subunit
12	61853.ENSNLEP00000019829	0.737	Ras-related GTP binding B
13	61853.ENSNLEP00000010632	0.736	Uncharacterized protein
14	61853.ENSNLEP00000011677	0.726	Serine/threonine-protein kinase mTOR
15	61853.ENSNLEP00000005768	0.718	DEP domain containing 5
16	61853.ENSNLEP00000003494	0.717	Integrin alpha FG-GAP repeat containing 2
17	61853.ENSNLEP00000019227	0.714	Regulatory associated protein of MTOR, complex 1
18	61853.ENSNLEP00000009719	0.690	NPR3 like, GATOR1 complex subunit
19	61853.ENSNLEP00000008544	0.686	NPR2 like, GATOR1 complex subunit
20	61853.ENSNLEP00000004377	0.676	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140311	1.000	protein sequestering activity
GO:0043169	1.000	cation binding
GO:0042802	1.000	identical protein binding
GO:0016597	1.000	amino acid binding
GO:0034618	0.993	arginine binding
GO:0003824	0.528	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0051716	0.995	cellular response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0043200	0.994	response to amino acid
GO:0071229	0.992	cellular response to acid chemical
GO:0071417	0.989	cellular response to organonitrogen compound
GO:1901701	0.985	cellular response to oxygen-containing compound
GO:0071230	0.983	cellular response to amino acid stimulus
GO:0009966	0.978	regulation of signal transduction
GO:1902531	0.971	regulation of intracellular signal transduction
GO:0032006	0.963	regulation of TOR signaling
GO:0048519	0.893	negative regulation of biological process
GO:0048523	0.861	negative regulation of cellular process
GO:1903432	0.861	regulation of TORC1 signaling
GO:0032007	0.854	negative regulation of TOR signaling
GO:1904262	0.810	negative regulation of TORC1 signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0061700	0.999	GATOR2 complex
GO:0005829	0.999	cytosol
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0016020	0.503	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]