StarFunc result for job id Q8WU10

User Input

>input (500 residues)
MEAARPPPTAGKFVVVGGGIAGVTCAEQLATHFPSEDILLVTASPVIKAVTNFKQISKIL
EEFDVEEQSSTMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKL
ICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAI
GNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWH
EGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDHKSVTADTEMWPVYV
ELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAGDIC
TTSWQLSPVWQQMRLWTQARQMGWYAAKCMAAASSGDSIDMDFSFELFAHVTKFFNYKVV
LLGKYNAQGLGSDHELMLRCTKGREYIKVVMQNGRMMGAVLIGETDLEETFENLILNQMN
LSSYGEDLLDPNIDIEDYFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WU10	1.000	1.000	2.373E-103	500	1.000	1.000	Q8WU10.pdb.gz	PYRD1_HUMAN Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYROXD1 PE=1 SV=1
2	AFDB:Q3TMV7	0.973	0.977	3.681E-90	498	0.848	0.851	Q3TMV7.pdb.gz	PYRD1_MOUSE Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyroxd1 PE=2 SV=1
3	PDB:6zk7AAAA	0.791	0.923	7.755E-72	425	0.846	0.995	6zk7AAAA.pdb.gz	The oxidoreductase PYROXD1 uses NAD(P) + as an antioxidant to sustain tRNA ligase activity in pre-tRNA splicing and unfolded protein response.
4	AFDB:X5CY81	0.635	0.766	5.851E-26	410	0.162	0.198	X5CY81.pdb.gz	CNDC1_RHIWD Chloroacetanilide N-alkylformylase, ferredoxin reductase component OS=Rhizorhabdus wittichii (strain DC-6 / KACC 16600) OX=1283312 GN=cndC1 PE=1 SV=1
5	AFDB:Q93WJ8	0.638	0.727	1.309E-24	435	0.180	0.207	Q93WJ8.pdb.gz	MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=MDAR2 PE=1 SV=1
6	AFDB:Q652L6	0.635	0.724	1.383E-24	435	0.166	0.191	Q652L6.pdb.gz	MDAR3_ORYSJ Monodehydroascorbate reductase 3, cytosolic OS=Oryza sativa subsp. japonica OX=39947 GN=MDAR3 PE=1 SV=1
7	AFDB:Q8L3B0	0.624	0.730	1.542E-24	421	0.168	0.200	Q8L3B0.pdb.gz	PADH_AROEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Aromatoleum evansii OX=59406 GN=padH PE=1 SV=1
8	AFDB:Q9SR59	0.639	0.719	1.629E-24	441	0.176	0.200	Q9SR59.pdb.gz	MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana OX=3702 GN=MDAR3 PE=2 SV=1
9	AFDB:D5IGG6	0.675	0.805	4.589E-24	414	0.150	0.181	D5IGG6.pdb.gz	FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. OX=28214 GN=fdr PE=1 SV=1
10	AFDB:P95034	0.640	0.777	7.917E-24	406	0.172	0.212	P95034.pdb.gz	P95034_MYCTU Ferredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0688 PE=1 SV=1
11	AFDB:P77650	0.654	0.806	1.098E-23	400	0.146	0.182	P77650.pdb.gz	HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) OX=83333 GN=hcaD PE=1 SV=1
12	PDB:5jciA	0.636	0.729	4.985E-23	432	0.164	0.190	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
13	PDB:1q1wA	0.624	0.731	2.819E-21	422	0.146	0.173	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.
14	PDB:2v3aA	0.584	0.747	3.703E-21	381	0.138	0.181	2v3aA.pdb.gz	Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
15	PDB:3kljA	0.566	0.731	5.136E-21	378	0.150	0.198	3kljA.pdb.gz	Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
16	PDB:7kmyA	0.593	0.632	4.493E-19	465	0.178	0.191	7kmyA.pdb.gz	Whole cell active inhibitors of mycobacterial lipoamide dehydrogenase afford selectivity over the human enzyme through tight binding interactions
17	PDB:4jdrA	0.588	0.622	6.155E-18	471	0.144	0.153	4jdrA.pdb.gz	Insight to the Interaction of the Dihydrolipoamide Acetyltransferase (E2) Core with the Peripheral Components in the Escherichia coli Pyruvate Dehydrogenase Complex via Multifaceted Structural Approaches.
18	PDB:1ebdA	0.561	0.611	8.537E-18	455	0.158	0.174	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.
19	PDB:6btlA	0.583	0.592	1.395E-17	492	0.154	0.157	6btlA.pdb.gz	Biological Evaluation and X-ray Co-crystal Structures of Cyclohexylpyrrolidine Ligands for Trypanothione Reductase, an Enzyme from the Redox Metabolism of Trypanosoma.
20	PDB:6hg8B	0.574	0.594	5.451E-17	482	0.130	0.135	6hg8B.pdb.gz	Crystal structure of the R460G disease-causing mutant of the human dihydrolipoamide dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TMV7	0.0	862	498	0.850	0.853	PYRD1_MOUSE Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyroxd1 PE=2 SV=1
2	Q8WU10	0.0	1042	500	1.000	1.000	PYRD1_HUMAN Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYROXD1 PE=1 SV=1
3	A7LKG5	8.88e-08	56.6	440	0.074	0.084	A7LKG5_ALKPO NADH dehydrogenase, NDH-2B OS=Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) OX=398511 GN=ndhB PE=4 SV=1
4	Q93WJ8	9.58e-06	50.4	435	0.064	0.074	MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana OX=3702 GN=MDAR2 PE=1 SV=1
5	P08201	1.79e-04	46.6	847	0.106	0.063	NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) OX=83333 GN=nirB PE=3 SV=4
6	Q9SR59	2.02e-04	46.2	441	0.086	0.098	MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana OX=3702 GN=MDAR3 PE=2 SV=1
7	Q96NN9	2.08e-04	46.2	605	0.094	0.078	AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=1
8	C9K029	2.24e-04	46.2	596	0.094	0.079	C9K029_HUMAN Apoptosis inducing factor mitochondria associated 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=3
9	Q3TY86	3.08e-04	45.8	605	0.092	0.076	AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus OX=10090 GN=Aifm3 PE=1 SV=1
10	Q652L6	4.96e-04	45.1	435	0.056	0.064	MDAR3_ORYSJ Monodehydroascorbate reductase 3, cytosolic OS=Oryza sativa subsp. japonica OX=39947 GN=MDAR3 PE=1 SV=1
11	Q10499	8.79e-04	44.3	611	0.108	0.088	AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aif1 PE=3 SV=3
12	F4J849	0.002	43.1	466	0.054	0.058	F4J849_ARATH Monodehydroascorbate reductase 1 OS=Arabidopsis thaliana OX=3702 GN=MDAR1 PE=1 SV=1
13	P42454	0.002	42.7	393	0.082	0.104	RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=rubB PE=1 SV=2
14	Q72AL8	0.002	42.7	367	0.048	0.065	Q72AL8_DESVH Pyridine nucleotide-disulfide oxidoreductase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1974 PE=1 SV=1
15	P48641	0.005	41.6	499	0.044	0.044	GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana OX=3702 GN=At3g24170 PE=1 SV=1
16	Q38A31	0.005	41.6	491	0.058	0.059	Q38A31_TRYB2 NADH dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0960 PE=3 SV=1
17	Q8MQU0	0.005	41.6	491	0.058	0.059	Q8MQU0_9TRYP Putative NADH dehydrogenase OS=Trypanosoma brucei OX=5691 PE=3 SV=1
18	F2Z4R3	0.008	41.2	599	0.092	0.077	F2Z4R3_DANRE Apoptosis-inducing factor 3 OS=Danio rerio OX=7955 GN=aifm3 PE=4 SV=1
19	Q9AL95	0.008	40.8	379	0.038	0.050	NROR_CLOAB NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=nroR PE=1 SV=1
20	X5CY81	0.009	40.8	410	0.062	0.076	CNDC1_RHIWD Chloroacetanilide N-alkylformylase, ferredoxin reductase component OS=Rhizorhabdus wittichii (strain DC-6 / KACC 16600) OX=1283312 GN=cndC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	1	20.5	FAD dependent oxidoreductase
2	PF00890 FAD_binding_2	8.3	17.0	FAD binding domain
3	PF01134 GIDA	12	16.5	Glucose inhibited division protein A
4	PF12700 HlyD_2	1.7e+02	12.4	HlyD family secretion protein
5	PF05834 Lycopene_cycl	4.9e+02	11.2	Lycopene cyclase protein
6	PF13434 Lys_Orn_oxgnase	0.69	20.6	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
7	PF13450 NAD_binding_8	23	16.7	NAD(P)-binding Rossmann-like domain
8	PF13454 NAD_binding_9	2e+02	13.5	FAD-NAD(P)-binding
9	PF00070 Pyr_redox	0.43	22.5	Pyridine nucleotide-disulphide oxidoreductase
10	PF07992 Pyr_redox_2	8.5e-27	105.8	Pyridine nucleotide-disulphide oxidoreductase
11	PF13738 Pyr_redox_3	0.13	23.1	Pyridine nucleotide-disulphide oxidoreductase
12	PF18267 Rubredoxin_C	3.9e-05	34.8	Rubredoxin NAD+ reductase C-terminal domain
13	PF04820 Trp_halogenase	1.7e+02	12.5	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362481	0.883	Uracil phosphoribosyltransferase homolog
2	9606.ENSP00000373647	0.757	Protein FAM83G
3	9606.ENSP00000309175	0.754	Probable RNA-binding protein EIF1AD
4	9606.ENSP00000398596	0.737	Phosphatidate cytidylyltransferase, mitochondrial
5	9606.ENSP00000359607	0.736	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
6	9606.ENSP00000368140	0.734	Cardiolipin synthase (CMP-forming)
7	9606.ENSP00000319255	0.730	Cysteine and histidine-rich domain-containing protein 1
8	9606.ENSP00000359518	0.723	MRG/MORF4L-binding protein
9	9606.ENSP00000357440	0.722	Heat shock factor protein 2
10	9606.ENSP00000254928	0.717	GTPase Era, mitochondrial
11	9606.ENSP00000263063	0.690	Poly(A) RNA polymerase, mitochondrial
12	9606.ENSP00000397459	0.674	Dual specificity protein phosphatase 22
13	9606.ENSP00000343885	0.645	Inorganic pyrophosphatase 2, mitochondrial
14	9606.ENSP00000469468	0.644	U6 snRNA-associated Sm-like protein LSm4
15	9606.ENSP00000365625	0.618	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
16	9606.ENSP00000229314	0.617	Vesicle transport protein GOT1B
17	9606.ENSP00000364813	0.611	U6 snRNA-associated Sm-like protein LSm2
18	9606.ENSP00000251047	0.610	Protein ERGIC-53
19	9606.ENSP00000323047	0.609	Mitochondrial ribosome-associated GTPase 1
20	9606.ENSP00000355434	0.592	Olfactory receptor 2L13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.987	catalytic activity
GO:0016491	0.930	oxidoreductase activity
GO:0097159	0.914	organic cyclic compound binding
GO:1901363	0.913	heterocyclic compound binding
GO:0036094	0.581	small molecule binding
GO:0043167	0.486	ion binding
GO:0000166	0.472	nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0062197	0.972	cellular response to chemical stress
GO:0006979	0.970	response to oxidative stress
GO:0034599	0.933	cellular response to oxidative stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0043233	0.930	organelle lumen
GO:0070013	0.908	intracellular organelle lumen
GO:0043232	0.815	intracellular non-membrane-bounded organelle
GO:0099080	0.521	supramolecular complex
GO:0099512	0.503	supramolecular fiber
GO:0030017	0.348	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.930	Oxidoreductases.

[back to server]