StarFunc result for job id Q8WU17

User Input

>input (664 residues)
MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLF
GVFASSIVLILSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLP
RKGPSLWMALIVLQLTFGIGYVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLF
TSSLILTLNTVFVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRV
FWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNLIISGCDSTLTVLGMSAVISS
VAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLL
TAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWL
FAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMF
GNGAYTMMFESGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRL
QEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSN
VSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFN
DDTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WU17	1.000	1.000	5.067E-86	664	1.000	1.000	Q8WU17.pdb.gz	RN139_HUMAN E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1
2	AFDB:Q7KRW1	0.763	0.632	1.553E-38	809	0.352	0.289	Q7KRW1.pdb.gz	TRC8_DROME Protein TRC8 homolog OS=Drosophila melanogaster OX=7227 GN=Trc8 PE=1 SV=1
3	AFDB:Q7ZWF4	0.709	0.689	4.380E-32	685	0.224	0.218	Q7ZWF4.pdb.gz	RN145_DANRE RING finger protein 145 OS=Danio rerio OX=7955 GN=rnf145 PE=2 SV=1
4	AFDB:Q9LW77	0.398	0.513	9.609E-11	492	0.111	0.150	Q9LW77.pdb.gz	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
5	AFDB:Q6NPT7	0.395	0.541	1.560E-10	460	0.110	0.159	Q6NPT7.pdb.gz	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
6	AFDB:F1QB30	0.415	0.440	1.134E-9	620	0.104	0.111	F1QB30.pdb.gz	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
7	AFDB:Q86TM6	0.384	0.408	4.253E-9	617	0.111	0.120	Q86TM6.pdb.gz	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
8	AFDB:Q95SP2	0.383	0.403	6.051E-9	626	0.096	0.102	Q95SP2.pdb.gz	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
9	AFDB:O74757	0.356	0.351	6.907E-9	677	0.110	0.108	O74757.pdb.gz	HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrd1 PE=1 SV=1
10	AFDB:Q9R049	0.419	0.432	8.609E-9	643	0.113	0.117	Q9R049.pdb.gz	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
11	PDB:4hnxA	0.113	0.107	1.978E-1	713	0.071	0.066	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
12	PDB:7mqaLM	0.093	0.052	2.257E-1	2041	0.095	0.031	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7pnt4	0.087	0.093	3.073E-1	589	0.093	0.105	7pnt4.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:6hivDG	0.105	0.116	3.831E-1	566	0.086	0.101	6hivDG.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7dskB	0.121	0.154	4.184E-1	464	0.069	0.099	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
16	PDB:7k36I	0.069	0.075	4.569E-1	599	0.092	0.102	7k36I.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
17	PDB:7mq8LM	0.098	0.053	4.569E-1	2005	0.119	0.039	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6ahd1	0.104	0.078	4.990E-1	1048	0.104	0.066	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
19	PDB:3ay5A	0.095	0.175	5.215E-1	298	0.051	0.114	3ay5A.pdb.gz
20	PDB:2q5dB	0.140	0.120	5.450E-1	845	0.078	0.062	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WU17	0.0	1371	664	1.000	1.000	RN139_HUMAN E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1
2	Q7KRW1	4.04e-117	371	809	0.301	0.247	TRC8_DROME Protein TRC8 homolog OS=Drosophila melanogaster OX=7227 GN=Trc8 PE=1 SV=1
3	Q7ZWF4	1.59e-59	214	685	0.262	0.254	RN145_DANRE RING finger protein 145 OS=Danio rerio OX=7955 GN=rnf145 PE=2 SV=1
4	Q9DBY1	6.57e-13	74.3	612	0.048	0.052	SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus OX=10090 GN=Syvn1 PE=1 SV=3
5	Q86TM6	8.89e-13	73.9	617	0.048	0.052	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
6	Q95SP2	3.05e-10	65.9	626	0.077	0.081	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
7	Q6PFU8	3.38e-09	62.4	620	0.084	0.090	Q6PFU8_DANRE Autocrine motility factor receptor OS=Danio rerio OX=7955 GN=amfr PE=2 SV=1
8	F1QB30	3.59e-09	62.4	620	0.084	0.090	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
9	Q20798	4.48e-09	62.0	610	0.072	0.079	HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans OX=6239 GN=sel-11 PE=3 SV=1
10	Q9Y4L5	7.52e-09	60.1	304	0.038	0.082	RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens OX=9606 GN=RNF115 PE=1 SV=2
11	Q9D0C1	7.86e-09	60.1	305	0.045	0.098	RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus OX=10090 GN=Rnf115 PE=1 SV=1
12	O54965	8.01e-09	60.5	381	0.053	0.092	RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus OX=10090 GN=Rnf13 PE=1 SV=2
13	A0A0G2K437	3.40e-08	59.3	770	0.048	0.042	A0A0G2K437_RAT Autocrine motility factor receptor OS=Rattus norvegicus OX=10116 GN=Amfr PE=1 SV=2
14	Q6NPT7	3.98e-08	58.5	460	0.053	0.076	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
15	Q9R049	5.89e-08	58.5	643	0.048	0.050	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
16	Q9UKV5	8.98e-08	57.8	643	0.048	0.050	AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2
17	P0CH30	9.45e-08	57.0	338	0.054	0.107	RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum OX=3635 GN=RING1 PE=1 SV=1
18	Q940T5	1.04e-07	57.0	407	0.047	0.076	RDUF2_ARATH E3 ubiquitin-protein ligase RDUF2 OS=Arabidopsis thaliana OX=3702 GN=DURF2 PE=1 SV=1
19	Q9H9V4	2.91e-07	52.8	155	0.048	0.206	RN122_HUMAN RING finger protein 122 OS=Homo sapiens OX=9606 GN=RNF122 PE=1 SV=2
20	A1A601	3.10e-07	55.1	310	0.054	0.116	A1A601_DANRE E3 ubiquitin-protein ligase RNF115 OS=Danio rerio OX=7955 GN=zgc:158455 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.74	21.0	Prokaryotic RING finger family 4
2	PF13705 TRC8_N	3.3e-182	618.4	TRC8 N-terminal domain
3	PF12861 zf-ANAPC11	1	20.7	Anaphase-promoting complex subunit 11 RING-H2 finger
4	PF00097 zf-C3HC4	0.0027	28.8	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	1.9e-05	35.7	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.21	22.8	Zinc finger, C3HC4 type (RING finger)
7	PF12678 zf-rbx1	0.00033	32.2	RING-H2 zinc finger domain
8	PF17123 zf-RING_11	0.5	21.4	RING-like zinc finger
9	PF16744 zf-RING_15	7.4e+02	11.7	KIAA1045 RING finger
10	PF17120 zf-RING_16	3.8e+02	12.1	RING/Ubox like zinc-binding domain
11	PF13639 zf-RING_2	7.6e-06	37.5	Ring finger domain
12	PF14634 zf-RING_5	0.21	22.9	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	12	17.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381237	0.963	Histocompatibility minor 13
2	9606.ENSP00000337053	0.921	Protein sel-1 homolog 1
3	9606.ENSP00000350512	0.920	COP9 signalosome complex subunit 5
4	9606.ENSP00000272317	0.908	Ubiquitin-40S ribosomal protein S27a
5	9606.ENSP00000304697	0.908	Polyubiquitin-B
6	9606.ENSP00000441543	0.908	Polyubiquitin-C
7	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000351777	0.891	Transitional endoplasmic reticulum ATPase
9	9606.ENSP00000344741	0.890	Insulin-induced gene 1 protein
10	9606.ENSP00000259512	0.885	Derlin-1
11	9606.ENSP00000318165	0.876	Protein OS-9
12	9606.ENSP00000158771	0.863	Derlin-2
13	9606.ENSP00000290649	0.857	E3 ubiquitin-protein ligase AMFR
14	9606.ENSP00000338348	0.840	Ubiquitin-conjugating enzyme E2 G2
15	9606.ENSP00000305941	0.828	Usherin
16	9606.ENSP00000366395	0.804	E3 ubiquitin-protein ligase synoviolin
17	9606.ENSP00000274140	0.784	E3 ubiquitin-protein ligase MARCH6
18	9606.ENSP00000287936	0.760	3-hydroxy-3-methylglutaryl-coenzyme A reductase
19	9606.ENSP00000372394	0.757	E3 ubiquitin-protein ligase TM129
20	9606.ENSP00000381282	0.738	Selenoprotein S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060089	1.000	molecular transducer activity
GO:0002020	1.000	protease binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0038023	0.994	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0070647	0.988	protein modification by small protein conjugation or removal
GO:0050794	0.986	regulation of cellular process
GO:0044237	0.986	cellular metabolic process
GO:0033554	0.986	cellular response to stress
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0009057	0.981	macromolecule catabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0044260	0.958	cellular macromolecule metabolic process
GO:0034976	0.958	response to endoplasmic reticulum stress
GO:0010498	0.957	proteasomal protein catabolic process
GO:0048523	0.954	negative regulation of cellular process
GO:0048518	0.953	positive regulation of biological process
GO:0036503	0.927	ERAD pathway
GO:1903050	0.919	regulation of proteolysis involved in protein catabolic process
GO:0009894	0.917	regulation of catabolic process
GO:0032446	0.891	protein modification by small protein conjugation
GO:0031647	0.881	regulation of protein stability
GO:0009893	0.856	positive regulation of metabolic process
GO:0010468	0.839	regulation of gene expression
GO:0009896	0.805	positive regulation of catabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0031648	0.785	protein destabilization
GO:1903317	0.734	regulation of protein maturation
GO:0010604	0.719	positive regulation of macromolecule metabolic process
GO:0051173	0.712	positive regulation of nitrogen compound metabolic process
GO:0051247	0.699	positive regulation of protein metabolic process
GO:0048522	0.651	positive regulation of cellular process
GO:0045862	0.642	positive regulation of proteolysis
GO:0016567	0.622	protein ubiquitination
GO:0032879	0.601	regulation of localization
GO:1903052	0.592	positive regulation of proteolysis involved in protein catabolic process
GO:0009892	0.585	negative regulation of metabolic process
GO:0009889	0.578	regulation of biosynthetic process
GO:0031326	0.564	regulation of cellular biosynthetic process
GO:0044248	0.561	cellular catabolic process
GO:0010556	0.510	regulation of macromolecule biosynthetic process
GO:0043632	0.505	modification-dependent macromolecule catabolic process
GO:0006511	0.458	ubiquitin-dependent protein catabolic process
GO:0031329	0.453	regulation of cellular catabolic process
GO:0043161	0.449	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0060341	0.419	regulation of cellular localization
GO:0051049	0.410	regulation of transport
GO:0032386	0.402	regulation of intracellular transport
GO:0006517	0.400	protein deglycosylation
GO:0010605	0.386	negative regulation of macromolecule metabolic process
GO:2000112	0.366	regulation of cellular macromolecule biosynthetic process
GO:0031325	0.360	positive regulation of cellular metabolic process
GO:0070613	0.358	regulation of protein processing
GO:0031324	0.352	negative regulation of cellular metabolic process
GO:0051172	0.346	negative regulation of nitrogen compound metabolic process
GO:0031327	0.333	negative regulation of cellular biosynthetic process
GO:0042127	0.320	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005789	0.997	endoplasmic reticulum membrane
GO:0098796	0.965	membrane protein complex
GO:0140534	0.933	endoplasmic reticulum protein-containing complex
GO:0036513	0.665	Derlin-1 retrotranslocation complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]