StarFunc result for job id Q8WU20

User Input

>input (508 residues)
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NQ31	0.259	0.258	1.089E-64	512	1.000	0.992	A0A384NQ31.pdb.gz	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:Q52RG8	0.323	0.333	1.880E-40	492	0.488	0.504	Q52RG8.pdb.gz	FRS3_RAT Fibroblast growth factor receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Frs3 PE=2 SV=3
3	AFDB:O43559	0.288	0.297	2.383E-39	492	0.484	0.500	O43559.pdb.gz	FRS3_HUMAN Fibroblast growth factor receptor substrate 3 OS=Homo sapiens OX=9606 GN=FRS3 PE=1 SV=3
4	AFDB:O43491	0.149	0.081	5.760E-5	1005	0.120	0.061	O43491.pdb.gz	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
5	AFDB:P35568	0.164	0.070	6.822E-5	1242	0.171	0.070	P35568.pdb.gz	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
6	AFDB:Q9XTN2	0.160	0.088	6.822E-5	968	0.154	0.081	Q9XTN2.pdb.gz	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
7	AFDB:E7F4P8	0.164	0.081	8.080E-5	1099	0.167	0.077	E7F4P8.pdb.gz	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
8	AFDB:F6P2Z4	0.143	0.107	1.199E-4	695	0.159	0.117	F6P2Z4.pdb.gz
9	AFDB:Q9DF49	0.154	0.077	1.343E-4	1074	0.169	0.080	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
10	AFDB:P49797	0.144	0.083	6.161E-4	967	0.144	0.075	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
11	PDB:6r9tA	0.152	0.037	4.009E-3	2185	0.024	0.005	6r9tA.pdb.gz
12	PDB:5yqrA	0.143	0.264	6.297E-3	268	0.022	0.041	5yqrA.pdb.gz
13	PDB:6xtbE	0.140	0.279	7.458E-3	235	0.043	0.094	6xtbE.pdb.gz
14	PDB:4rm8A	0.139	0.186	1.739E-2	368	0.028	0.038	4rm8A.pdb.gz
15	PDB:5oqj1	0.137	0.141	2.059E-2	491	0.020	0.020	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
16	PDB:7c3mA	0.135	0.121	2.731E-2	577	0.037	0.033	7c3mA.pdb.gz
17	PDB:7r04B	0.138	0.033	4.289E-2	2229	0.020	0.004	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
18	PDB:7r03B	0.145	0.034	4.801E-2	2246	0.018	0.004	7r03B.pdb.gz
19	PDB:4gnkB	0.148	0.100	5.687E-2	769	0.024	0.016	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
20	PDB:2hzqA	0.098	0.207	6.366E-2	166	0.045	0.139	2hzqA.pdb.gz	Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein d.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NQ31	0.0	1052	512	1.000	0.992	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
2	D4A244	0.0	924	508	0.955	0.955	D4A244_RAT Fibroblast growth factor receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Frs2 PE=1 SV=1
3	Q8C180	0.0	926	508	0.959	0.959	FRS2_MOUSE Fibroblast growth factor receptor substrate 2 OS=Mus musculus OX=10090 GN=Frs2 PE=1 SV=3
4	Q8WU20	0.0	1053	508	1.000	1.000	FRS2_HUMAN Fibroblast growth factor receptor substrate 2 OS=Homo sapiens OX=9606 GN=FRS2 PE=1 SV=4
5	O43559	7.24e-150	439	492	0.494	0.510	FRS3_HUMAN Fibroblast growth factor receptor substrate 3 OS=Homo sapiens OX=9606 GN=FRS3 PE=1 SV=3
6	Q52RG8	2.47e-148	435	492	0.498	0.514	FRS3_RAT Fibroblast growth factor receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Frs3 PE=2 SV=3
7	P97465	5.58e-09	60.8	482	0.065	0.068	DOK1_MOUSE Docking protein 1 OS=Mus musculus OX=10090 GN=Dok1 PE=1 SV=2
8	Q99704	6.14e-09	60.5	481	0.065	0.069	DOK1_HUMAN Docking protein 1 OS=Homo sapiens OX=9606 GN=DOK1 PE=1 SV=1
9	Q9QZK7	8.21e-09	60.1	444	0.047	0.054	DOK3_MOUSE Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3 PE=1 SV=1
10	O70469	1.06e-07	56.6	412	0.043	0.053	DOK2_MOUSE Docking protein 2 OS=Mus musculus OX=10090 GN=Dok2 PE=1 SV=1
11	O60496	1.82e-07	55.8	412	0.051	0.063	DOK2_HUMAN Docking protein 2 OS=Homo sapiens OX=9606 GN=DOK2 PE=1 SV=2
12	Q9W3R6	2.15e-07	55.8	622	0.047	0.039	Q9W3R6_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=Dok PE=2 SV=1
13	Q2MHE5	2.91e-07	54.7	331	0.053	0.082	DOK6_MOUSE Docking protein 6 OS=Mus musculus OX=10090 GN=Dok6 PE=1 SV=1
14	Q6PKX4	2.99e-07	54.7	331	0.053	0.082	DOK6_HUMAN Docking protein 6 OS=Homo sapiens OX=9606 GN=DOK6 PE=1 SV=1
15	Q7L591	7.58e-07	53.9	496	0.041	0.042	DOK3_HUMAN Docking protein 3 OS=Homo sapiens OX=9606 GN=DOK3 PE=1 SV=2
16	Q91ZM9	3.34e-06	51.2	306	0.047	0.078	DOK5_MOUSE Docking protein 5 OS=Mus musculus OX=10090 GN=Dok5 PE=1 SV=1
17	Q9P104	3.59e-06	51.2	306	0.047	0.078	DOK5_HUMAN Docking protein 5 OS=Homo sapiens OX=9606 GN=DOK5 PE=1 SV=2
18	Q99KE3	1.75e-05	49.3	325	0.035	0.055	DOK4_MOUSE Docking protein 4 OS=Mus musculus OX=10090 GN=Dok4 PE=1 SV=1
19	Q8TEW6	1.83e-05	49.3	326	0.035	0.055	DOK4_HUMAN Docking protein 4 OS=Homo sapiens OX=9606 GN=DOK4 PE=1 SV=2
20	A4IFJ7	1.99e-05	48.9	326	0.035	0.055	A4IFJ7_BOVIN DOK4 protein OS=Bos taurus OX=9913 GN=DOK4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	3.8e-20	83.0	PTB domain (IRS-1 type)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447241

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
3	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
4	9606.ENSP00000410294	0.999	Fibroblast growth factor receptor 2
5	9606.ENSP00000431418	0.998	High affinity nerve growth factor receptor
6	9606.ENSP00000387784	0.995	Son of sevenless homolog 1
7	9606.ENSP00000300574	0.994	Adapter molecule crk
8	9606.ENSP00000362680	0.992	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000277120	0.990	BDNF/NT-3 growth factors receptor
10	9606.ENSP00000264033	0.984	E3 ubiquitin-protein ligase CBL
11	9606.ENSP00000347942	0.982	Proto-oncogene tyrosine-protein kinase receptor Ret
12	9606.ENSP00000262995	0.981	GRB2-associated-binding protein 1
13	9606.ENSP00000401303	0.980	SHC-transforming protein 1
14	9606.ENSP00000366306	0.977	Protein sprouty homolog 2
15	9606.ENSP00000215832	0.975	Mitogen-activated protein kinase 1
16	9606.ENSP00000339824	0.973	Fibroblast growth factor receptor 3
17	9606.ENSP00000263025	0.968	Mitogen-activated protein kinase 3
18	9606.ENSP00000346300	0.964	Crk-like protein
19	9606.ENSP00000256078	0.951	GTPase KRas
20	9606.ENSP00000358525	0.950	Beta-nerve growth factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.965	signaling receptor binding
GO:0019899	0.728	enzyme binding
GO:0019901	0.504	protein kinase binding
GO:1990782	0.489	protein tyrosine kinase binding
GO:0035591	0.472	signaling adaptor activity
GO:0030971	0.471	receptor tyrosine kinase binding
GO:0030159	0.446	signaling receptor complex adaptor activity
GO:0005068	0.432	transmembrane receptor protein tyrosine kinase adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0050794	0.999	regulation of cellular process
GO:0071774	0.994	response to fibroblast growth factor
GO:0007165	0.987	signal transduction
GO:0071363	0.985	cellular response to growth factor stimulus
GO:0044344	0.979	cellular response to fibroblast growth factor stimulus
GO:0048522	0.976	positive regulation of cellular process
GO:0007167	0.966	enzyme-linked receptor protein signaling pathway
GO:0042127	0.959	regulation of cell population proliferation
GO:0007169	0.958	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0050793	0.929	regulation of developmental process
GO:0008543	0.885	fibroblast growth factor receptor signaling pathway
GO:0048519	0.810	negative regulation of biological process
GO:0048523	0.796	negative regulation of cellular process
GO:0051239	0.724	regulation of multicellular organismal process
GO:0008284	0.705	positive regulation of cell population proliferation
GO:0032502	0.674	developmental process
GO:0048856	0.599	anatomical structure development
GO:0048583	0.510	regulation of response to stimulus
GO:0023051	0.497	regulation of signaling
GO:0007275	0.491	multicellular organism development
GO:0010646	0.489	regulation of cell communication
GO:0009966	0.452	regulation of signal transduction
GO:0048731	0.389	system development
GO:1902531	0.335	regulation of intracellular signal transduction
GO:0048584	0.332	positive regulation of response to stimulus
GO:0009967	0.321	positive regulation of signal transduction
GO:0019222	0.301	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0030054	0.971	cell junction
GO:0070161	0.869	anchoring junction
GO:0005911	0.740	cell-cell junction
GO:0043226	0.729	organelle
GO:0043229	0.723	intracellular organelle
GO:0043231	0.693	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]