StarFunc result for job id Q8WU67

User Input

>input (409 residues)
MQRLAMDLRMLSRELSLYLEHQVRVGFFGSGVGLSLILGFSVAYAFYYLSSIAKKPQLVT
GGESFSRFLQDHCPVVTETYYPTVWCWEGRGQTLLRPFITSKPPVQYRNELIKTADGGQI
SLDWFDNDNSTCYMDASTRPTILLLPGLTGTSKESYILHMIHLSEELGYRCVVFNNRGVA
GENLLTPRTYCCANTEDLETVIHHVHSLYPSAPFLAAGVSMGGMLLLNYLGKIGSKTPLM
AAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVNKHRHMFVKQVDMDHVMKAKS
IREFDKRFTSVMFGYQTIDDYYTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAK
QNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMVEHGHELS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91ZH7	0.978	0.973	1.625E-80	411	0.932	0.927	Q91ZH7.pdb.gz	ABHD3_MOUSE Phospholipase ABHD3 OS=Mus musculus OX=10090 GN=Abhd3 PE=1 SV=1
2	AFDB:Q96SE0	0.895	0.903	5.331E-49	405	0.428	0.432	Q96SE0.pdb.gz	ABHD1_HUMAN Protein ABHD1 OS=Homo sapiens OX=9606 GN=ABHD1 PE=1 SV=2
3	AFDB:Q9SVL9	0.813	0.815	4.442E-36	408	0.281	0.282	Q9SVL9.pdb.gz	Q9SVL9_ARATH Esterase/lipase/thioesterase family protein OS=Arabidopsis thaliana OX=3702 GN=F18B3.70 PE=1 SV=1
4	AFDB:P08910	0.812	0.782	1.951E-31	425	0.227	0.219	P08910.pdb.gz	ABHD2_HUMAN Monoacylglycerol lipase ABHD2 OS=Homo sapiens OX=9606 GN=ABHD2 PE=1 SV=1
5	AFDB:Q24093	0.814	0.836	4.823E-31	398	0.240	0.246	Q24093.pdb.gz	ABHD2_DROME Abhydrolase domain-containing protein 2 OS=Drosophila melanogaster OX=7227 GN=Hydr2 PE=2 SV=2
6	AFDB:Q54H38	0.810	0.838	4.823E-31	395	0.249	0.258	Q54H38.pdb.gz	ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=abhd PE=1 SV=1
7	AFDB:Q03649	0.755	0.690	3.668E-27	449	0.225	0.205	Q03649.pdb.gz	MGL2_YEAST Monoacylglycerol lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGL2 PE=1 SV=1
8	AFDB:Q02891	0.743	0.669	3.881E-27	456	0.242	0.217	Q02891.pdb.gz	MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EEB1 PE=1 SV=1
9	AFDB:P38295	0.753	0.685	9.067E-27	451	0.235	0.213	P38295.pdb.gz	MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EHT1 PE=1 SV=1
10	AFDB:Q6UXT9	0.745	0.656	9.370E-25	468	0.230	0.201	Q6UXT9.pdb.gz	ABH15_HUMAN Protein ABHD15 OS=Homo sapiens OX=9606 GN=ABHD15 PE=1 SV=2
11	PDB:3e3aB	0.400	0.566	4.564E-11	275	0.115	0.171	3e3aB.pdb.gz
12	PDB:6eicB	0.425	0.600	7.295E-10	279	0.088	0.129	6eicB.pdb.gz
13	PDB:5jzsB	0.386	0.525	2.019E-9	284	0.100	0.144	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
14	PDB:1k8qA	0.438	0.470	3.175E-9	377	0.134	0.146	1k8qA.pdb.gz	Crystal structure of the open form of dog gastric lipase in complex with a phosphonate inhibitor.
15	PDB:2xe4A	0.451	0.272	4.212E-9	721	0.095	0.054	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
16	PDB:2wm2C	0.379	0.518	4.991E-9	277	0.142	0.209	2wm2C.pdb.gz	Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
17	PDB:2vavB	0.358	0.409	6.259E-9	350	0.108	0.126	2vavB.pdb.gz	The last step in cephalosporin C formation revealed: crystal structures of deacetylcephalosporin C acetyltransferase from Acremonium chrysogenum in complexes with reaction intermediates.
18	PDB:1u2eA	0.430	0.589	1.166E-8	286	0.125	0.178	1u2eA.pdb.gz
19	PDB:2ocgA	0.369	0.562	1.833E-8	254	0.103	0.165	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
20	PDB:3c6bA	0.420	0.558	2.053E-8	291	0.115	0.162	3c6bA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WU67	0.0	856	409	1.000	1.000	ABHD3_HUMAN Phospholipase ABHD3 OS=Homo sapiens OX=9606 GN=ABHD3 PE=2 SV=2
2	Q91ZH7	0.0	808	411	0.934	0.929	ABHD3_MOUSE Phospholipase ABHD3 OS=Mus musculus OX=10090 GN=Abhd3 PE=1 SV=1
3	Q96SE0	6.17e-122	361	405	0.411	0.415	ABHD1_HUMAN Protein ABHD1 OS=Homo sapiens OX=9606 GN=ABHD1 PE=1 SV=2
4	Q9SVL9	1.05e-55	191	408	0.262	0.262	Q9SVL9_ARATH Esterase/lipase/thioesterase family protein OS=Arabidopsis thaliana OX=3702 GN=F18B3.70 PE=1 SV=1
5	Q54H38	5.17e-44	159	395	0.237	0.246	ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=abhd PE=1 SV=1
6	Q9QXM0	3.08e-35	136	425	0.227	0.219	ABHD2_MOUSE Monoacylglycerol lipase ABHD2 OS=Mus musculus OX=10090 GN=Abhd2 PE=1 SV=1
7	P08910	5.99e-35	135	425	0.227	0.219	ABHD2_HUMAN Monoacylglycerol lipase ABHD2 OS=Homo sapiens OX=9606 GN=ABHD2 PE=1 SV=1
8	Q24093	4.80e-32	127	398	0.235	0.241	ABHD2_DROME Abhydrolase domain-containing protein 2 OS=Drosophila melanogaster OX=7227 GN=Hydr2 PE=2 SV=2
9	Q03649	3.08e-29	120	449	0.203	0.185	MGL2_YEAST Monoacylglycerol lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGL2 PE=1 SV=1
10	Q02891	2.00e-27	115	456	0.237	0.213	MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EEB1 PE=1 SV=1
11	Q6UXT9	8.23e-27	113	468	0.203	0.177	ABH15_HUMAN Protein ABHD15 OS=Homo sapiens OX=9606 GN=ABHD15 PE=1 SV=2
12	P38295	1.11e-24	107	451	0.230	0.208	MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EHT1 PE=1 SV=1
13	P9WNH1	0.001	42.7	262	0.154	0.240	BPOC_MYCTU Putative non-heme bromoperoxidase BpoC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bpoC PE=1 SV=1
14	Q9DAP7	1.7	32.7	202	0.056	0.114	ASF1B_MOUSE Histone chaperone ASF1B OS=Mus musculus OX=10090 GN=Asf1b PE=1 SV=1
15	Q869X2	2.0	33.5	2604	0.081	0.013	PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum OX=44689 GN=pks17 PE=3 SV=1
16	Q8N2K0	3.4	32.3	398	0.056	0.058	ABD12_HUMAN Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12 PE=1 SV=2
17	Q9NVP2	3.4	31.6	202	0.056	0.114	ASF1B_HUMAN Histone chaperone ASF1B OS=Homo sapiens OX=9606 GN=ASF1B PE=1 SV=1
18	K7ES22	4.2	30.8	143	0.049	0.140	K7ES22_HUMAN Anti-silencing function 1B histone chaperone OS=Homo sapiens OX=9606 GN=ASF1B PE=1 SV=1
19	Q9NUJ1	4.4	31.6	306	0.049	0.065	ABHDA_HUMAN Palmitoyl-protein thioesterase ABHD10, mitochondrial OS=Homo sapiens OX=9606 GN=ABHD10 PE=1 SV=1
20	Q8IQV9	4.6	32.3	2090	0.046	0.009	NU205_DROME Nuclear pore complex protein Nup205 OS=Drosophila melanogaster OX=7227 GN=Nup205 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	2.5e-06	38.9	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	0.00065	31.9	Alpha/beta hydrolase family
3	PF19365 DUF5941	5.5e+02	11.9	Family of unknown function (DUF5941)
4	PF12146 Hydrolase_4	0.029	25.2	Serine aminopeptidase, S33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289119

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256925	0.753	CDK5 and ABL1 enzyme substrate 1
2	9606.ENSP00000320291	0.727	Oxysterol-binding protein-related protein 1
3	9606.ENSP00000279101	0.704	CDK5 and ABL1 enzyme substrate 2
4	9606.ENSP00000261600	0.694	THO complex subunit 1
5	9606.ENSP00000414558	0.671	Protein ABHD4
6	9606.ENSP00000464162	0.670	GREB1-like protein
7	9606.ENSP00000379282	0.658	Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS) (By similarity). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes (By similarity). Has no activity towards diacylglycerol, triacylglycerol or lysophosphatidylserine lipase . Also has monoacylglycerol lipase activity, with preference for 1-(9Z,12Z- octadecadienoyl)-glycerol (1-LG) and 2-glyceryl-15-deoxy-Delta(12,14)- prostaglandin J2 (15d-PGJ(2)-G) .
8	9606.ENSP00000222800	0.655	Protein ABHD11
9	9606.ENSP00000420315	0.655	Monoacylglycerol lipase ABHD6
10	9606.ENSP00000382697	0.644	Rho-associated protein kinase 1
11	9606.ENSP00000365725	0.636	Monoacylglycerol lipase ABHD12
12	9606.ENSP00000273359	0.635	Mycophenolic acid acyl-glucuronide esterase, mitochondrial
13	9606.ENSP00000417580	0.628	Isoamyl acetate-hydrolyzing esterase 1 homolog
14	9606.ENSP00000261601	0.596	Ubiquitin carboxyl-terminal hydrolase 14
15	9606.ENSP00000273596	0.586	Protein ABHD14A
16	9606.ENSP00000365063	0.583	Protein ABHD13
17	9606.ENSP00000394869	0.582	Translation initiation factor eIF-2B subunit delta
18	9606.ENSP00000261537	0.580	E3 ubiquitin-protein ligase MIB1
19	9606.ENSP00000336693	0.578	Belongs to the serine esterase family
20	9606.ENSP00000390849	0.567	1-acylglycerol-3-phosphate O-acyltransferase ABHD5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004623	0.995	phospholipase A2 activity
GO:0008970	0.992	phospholipase A1 activity
GO:0005515	0.970	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046486	0.997	glycerolipid metabolic process
GO:0006796	0.995	phosphate-containing compound metabolic process
GO:1901564	0.992	organonitrogen compound metabolic process
GO:0006650	0.989	glycerophospholipid metabolic process
GO:0046470	0.942	phosphatidylcholine metabolic process
GO:0044249	0.923	cellular biosynthetic process
GO:0008610	0.884	lipid biosynthetic process
GO:0046474	0.861	glycerophospholipid biosynthetic process
GO:0006656	0.690	phosphatidylcholine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005886	0.991	plasma membrane
GO:0005622	0.907	intracellular anatomical structure
GO:0043226	0.886	organelle
GO:0043229	0.878	intracellular organelle
GO:0005737	0.863	cytoplasm
GO:0043227	0.858	membrane-bounded organelle
GO:0043231	0.832	intracellular membrane-bounded organelle
GO:0005634	0.389	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15801	0.995	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	0.995	phospholipase A2.
RHEA:18689	0.992	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.32	0.992	phospholipase A1.

[back to server]