StarFunc result for job id Q8WUF5

User Input

>input (828 residues)
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
AGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS
PRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL
TLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP
QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD
EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG
ITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF
ATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR
EGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0Q5	0.337	0.337	0.000	828	1.000	1.000	A0A024R0Q5.pdb.gz
2	AFDB:F1LW07	0.464	0.466	0.000	825	0.880	0.884	F1LW07.pdb.gz	F1LW07_RAT Protein phosphatase 1, regulatory subunit 13 like OS=Rattus norvegicus OX=10116 GN=Ppp1r13l PE=1 SV=2
3	AFDB:F1M5H6	0.266	0.197	5.309E-37	1128	0.297	0.218	F1M5H6.pdb.gz	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
4	AFDB:Q13625	0.266	0.199	6.432E-35	1128	0.286	0.210	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
5	PDB:8cs9A	0.125	0.130	1.145E-7	796	0.043	0.045	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	PDB:6jd6B	0.115	0.369	2.708E-7	192	0.048	0.208	6jd6B.pdb.gz
7	AFDB:Q9BX66	0.068	0.047	3.628E-7	1292	0.165	0.106	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
8	PDB:7df7B	0.129	0.823	9.852E-7	119	0.041	0.286	7df7B.pdb.gz
9	PDB:2dvwA	0.135	0.474	2.636E-6	229	0.042	0.153	2dvwA.pdb.gz
10	PDB:4oauC	0.138	0.165	2.636E-6	692	0.040	0.048	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
11	PDB:6v9hC	0.135	0.398	2.803E-6	270	0.036	0.111	6v9hC.pdb.gz
12	PDB:3ehqA	0.135	0.579	4.875E-6	182	0.037	0.170	3ehqA.pdb.gz
13	PDB:6mwqA	0.142	0.234	9.589E-6	493	0.048	0.081	6mwqA.pdb.gz
14	PDB:5vkqA	0.138	0.077	1.226E-5	1499	0.041	0.023	5vkqA.pdb.gz
15	PDB:1wg0A	0.132	0.436	3.085E-5	243	0.041	0.140	1wg0A.pdb.gz
16	AFDB:A0A024R885	0.069	0.064	5.325E-3	898	0.179	0.165	A0A024R885.pdb.gz
17	AFDB:Q6W2J9	0.140	0.069	1.047E-2	1755	0.165	0.078	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
18	AFDB:Q6BCL1	0.058	0.070	2.191E-2	675	0.136	0.167	Q6BCL1.pdb.gz	PRAM_MOUSE PML-RARA-regulated adapter molecule 1 OS=Mus musculus OX=10090 GN=Pram1 PE=1 SV=2
19	AFDB:Q9D8C3	0.038	0.031	3.811E-2	1166	0.127	0.090	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
20	AFDB:Q96QH2	0.079	0.095	4.874E-2	670	0.162	0.200	Q96QH2.pdb.gz	PRAM_HUMAN PML-RARA-regulated adapter molecule 1 OS=Homo sapiens OX=9606 GN=PRAM1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LW07	0.0	1288	825	0.872	0.875	F1LW07_RAT Protein phosphatase 1, regulatory subunit 13 like OS=Rattus norvegicus OX=10116 GN=Ppp1r13l PE=1 SV=2
2	Q5I1X5	0.0	1295	824	0.884	0.888	IASPP_MOUSE RelA-associated inhibitor OS=Mus musculus OX=10090 GN=Ppp1r13l PE=1 SV=1
3	Q8WUF5	0.0	1642	828	1.000	1.000	IASPP_HUMAN RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4
4	D4A6A8	5.43e-83	289	1042	0.163	0.130	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
5	A0A0G2KB61	6.15e-83	289	1088	0.163	0.124	A0A0G2KB61_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=2
6	A0A8I6A8S6	9.30e-83	289	1123	0.163	0.120	A0A8I6A8S6_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=4 SV=1
7	Q1LXN7	1.35e-82	288	1060	0.153	0.120	Q1LXN7_DANRE Tumor protein p53 binding protein, 2 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=1
8	F1QWN1	1.41e-82	288	1063	0.153	0.119	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
9	A0A3B3ISJ2	1.53e-82	288	1075	0.157	0.121	A0A3B3ISJ2_HUMAN Protein phosphatase 1 regulatory subunit 13B (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=1
10	Q96KQ4	1.96e-82	288	1090	0.157	0.119	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
11	Q6NSN9	6.64e-82	286	1060	0.147	0.115	Q6NSN9_DANRE Apoptosis-stimulating of p53 protein 2 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
12	A0A8I6A5P5	1.09e-81	285	1040	0.147	0.117	A0A8I6A5P5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
13	F1R419	1.25e-81	285	1060	0.147	0.115	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
14	A0A8I6ANU5	4.49e-81	284	1119	0.156	0.115	A0A8I6ANU5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=4 SV=1
15	F1M5H6	4.71e-81	285	1128	0.156	0.114	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
16	Q05BL1	1.13e-80	282	1048	0.145	0.115	Q05BL1_HUMAN TP53BP2 protein OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=1
17	Q13625	6.48e-80	281	1128	0.145	0.106	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
18	K7EN03	1.37e-79	254	128	0.155	1.000	K7EN03_HUMAN Protein phosphatase 1 regulatory subunit 13 like (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=1
19	A0A8I6AMB5	6.14e-76	270	1146	0.146	0.106	A0A8I6AMB5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
20	Q8CG79	1.58e-71	257	1128	0.149	0.109	ASPP2_MOUSE Apoptosis-stimulating of p53 protein 2 OS=Mus musculus OX=10090 GN=Tp53bp2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.1e-06	38.6	Ankyrin repeat
2	PF12796 Ank_2	8.9e-11	53.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.4e-05	34.1	Ankyrin repeat
4	PF13637 Ank_4	0.00039	32.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.9e-06	38.7	Ankyrin repeats (many copies)
6	PF00018 SH3_1	4.1e-06	37.6	SH3 domain
7	PF07653 SH3_2	7.6e-05	33.8	Variant SH3 domain
8	PF14604 SH3_9	2.6e-07	41.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403902

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
2	9606.ENSP00000341779	0.924	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
3	9606.ENSP00000367545	0.921	Tumor protein p73
4	9606.ENSP00000326031	0.908	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
5	9606.ENSP00000384273	0.896	Transcription factor p65
6	9606.ENSP00000465099	0.893	DNA-directed RNA polymerase I subunit RPA34
7	9606.ENSP00000171111	0.887	Kelch-like ECH-associated protein 1
8	9606.ENSP00000364721	0.865	Microtubule-associated protein RP/EB family member 1
9	9606.ENSP00000375809	0.860	TFIIH basal transcription factor complex helicase XPD subunit
10	9606.ENSP00000264731	0.835	Tumor protein 63
11	9606.ENSP00000299163	0.806	Hypoxia-inducible factor 1-alpha inhibitor
12	9606.ENSP00000378769	0.798	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
13	9606.ENSP00000163416	0.695	Golgin subfamily A member 5
14	9606.ENSP00000458986	0.683	Clustered mitochondria protein homolog
15	9606.ENSP00000258149	0.671	E3 ubiquitin-protein ligase Mdm2
16	9606.ENSP00000356150	0.600	Protein Mdm4
17	9606.ENSP00000329357	0.583	Transcription factor Sp1
18	9606.ENSP00000369129	0.583	Desmoplakin
19	9606.ENSP00000263253	0.530	Histone acetyltransferase p300
20	9606.ENSP00000216714	0.512	DNA-(apurinic or apyrimidinic site) lyase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.753	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.931	positive regulation of biological process
GO:0048522	0.906	positive regulation of cellular process
GO:0009987	0.873	cellular process
GO:0019222	0.693	regulation of metabolic process
GO:0060255	0.580	regulation of macromolecule metabolic process
GO:0031323	0.578	regulation of cellular metabolic process
GO:0051171	0.571	regulation of nitrogen compound metabolic process
GO:0080090	0.568	regulation of primary metabolic process
GO:0050896	0.512	response to stimulus
GO:0048856	0.456	anatomical structure development
GO:0048519	0.440	negative regulation of biological process
GO:0048523	0.389	negative regulation of cellular process
GO:0032501	0.385	multicellular organismal process
GO:0006355	0.376	regulation of DNA-templated transcription
GO:0071704	0.339	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.997	nucleoplasm
GO:0030054	0.994	cell junction
GO:0045171	0.991	intercellular bridge
GO:0043232	0.507	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]