StarFunc result for job id Q8WUF8

User Input

>input (416 residues)
MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTL
EGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLK
KVSIPVDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQ
IPFIKRAVAEGYGVIVLNPNENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKR
RDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFV
ELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESM
LPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TNH5	0.830	0.828	2.779E-75	417	0.933	0.930	Q3TNH5.pdb.gz	F172A_MOUSE Cotranscriptional regulator FAM172A OS=Mus musculus OX=10090 GN=Fam172a PE=1 SV=2
2	AFDB:Q95RN0	0.646	0.822	4.866E-30	325	0.267	0.342	Q95RN0.pdb.gz	F172A_DROME FAM172 family protein homolog CG10038 OS=Drosophila melanogaster OX=7227 GN=CG10038 PE=2 SV=1
3	AFDB:Q10271	0.643	0.819	2.069E-16	321	0.130	0.168	Q10271.pdb.gz	ARB2_SCHPO Argonaute-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arb2 PE=1 SV=3
4	AFDB:P56523	0.446	0.283	7.326E-9	687	0.099	0.060	P56523.pdb.gz	CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr3 PE=1 SV=1
5	PDB:5ikkA	0.413	0.296	4.367E-8	594	0.091	0.064	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
6	AFDB:P53973	0.414	0.255	1.354E-7	706	0.118	0.069	P53973.pdb.gz	HDA1_YEAST Histone deacetylase HDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HDA1 PE=1 SV=1
7	PDB:6z6fB	0.385	0.254	3.173E-7	661	0.103	0.065	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
8	PDB:4e15B	0.292	0.375	2.671E-5	303	0.096	0.132	4e15B.pdb.gz
9	AFDB:Q94AM5	0.236	0.216	3.559E-4	463	0.120	0.108	Q94AM5.pdb.gz	Q94AM5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL4 PE=1 SV=1
10	AFDB:O02218	0.256	0.289	1.719E-3	360	0.065	0.075	O02218.pdb.gz	LID1_CAEEL Abhydrolase domain-containing protein lid-1 OS=Caenorhabditis elegans OX=6239 GN=lid-1 PE=1 SV=2
11	AFDB:P07000	0.248	0.295	2.171E-3	340	0.075	0.091	P07000.pdb.gz	PLDB_ECOLI Lysophospholipase L2 OS=Escherichia coli (strain K12) OX=83333 GN=pldB PE=1 SV=4
12	PDB:5kwiA	0.249	0.347	2.840E-3	283	0.070	0.102	5kwiA.pdb.gz	Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
13	PDB:2qvbB	0.225	0.302	7.221E-3	297	0.079	0.111	2qvbB.pdb.gz
14	PDB:6eicB	0.222	0.304	1.221E-2	279	0.091	0.136	6eicB.pdb.gz
15	PDB:3c6bA	0.312	0.414	1.372E-2	291	0.089	0.127	3c6bA.pdb.gz
16	PDB:2wm2C	0.206	0.293	1.634E-2	277	0.072	0.108	2wm2C.pdb.gz	Structural Basis for Cofactor-Independent Dioxygenation of N-Heteroaromatic Compounds at the {Alpha}/{Beta}-Hydrolase Fold.
17	PDB:3fcxB	0.279	0.389	1.732E-2	275	0.084	0.127	3fcxB.pdb.gz	Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
18	PDB:2y6vC	0.219	0.239	1.947E-2	377	0.075	0.082	2y6vC.pdb.gz
19	AFDB:I6Y2J4	0.252	0.241	2.515E-2	437	0.070	0.066	I6Y2J4.pdb.gz	LIPY_MYCTU Triacylglycerol lipase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lipY PE=1 SV=1
20	AFDB:P9WP43	0.303	0.518	3.783E-2	217	0.084	0.161	P9WP43.pdb.gz	CULP1_MYCTU Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TNH5	0.0	816	417	0.933	0.930	F172A_MOUSE Cotranscriptional regulator FAM172A OS=Mus musculus OX=10090 GN=Fam172a PE=1 SV=2
2	Q8WUF8	0.0	866	416	1.000	1.000	F172A_HUMAN Cotranscriptional regulator FAM172A OS=Homo sapiens OX=9606 GN=FAM172A PE=1 SV=1
3	Q95RN0	1.52e-50	175	325	0.281	0.360	F172A_DROME FAM172 family protein homolog CG10038 OS=Drosophila melanogaster OX=7227 GN=CG10038 PE=2 SV=1
4	Q10271	3.98e-04	44.7	321	0.079	0.103	ARB2_SCHPO Argonaute-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arb2 PE=1 SV=3
5	Q7XA66	0.10	36.6	242	0.082	0.140	ZOP1_ARATH Zinc finger protein ZOP1 OS=Arabidopsis thaliana OX=3702 GN=ZOP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09757 Arb2	3.7e-06	37.8	Arb2 domain
2	PF12146 Hydrolase_4	38	15.0	Serine aminopeptidase, S33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379294

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309087	0.788	PLAC8-like protein 1
2	9606.ENSP00000265140	0.741	SMC5-SMC6 complex localization factor protein 1
3	9606.ENSP00000424126	0.727	Multiple C2 and transmembrane domain-containing protein 1
4	9606.ENSP00000295588	0.641	Protein O-glucosyltransferase 1
5	9606.ENSP00000361926	0.635	Protein canopy homolog 3
6	9606.ENSP00000360688	0.630	Thioredoxin domain-containing protein 12
7	9606.ENSP00000380401	0.626	FAD-dependent oxidoreductase domain-containing protein 2
8	9606.ENSP00000222803	0.625	Peptidyl-prolyl cis-trans isomerase FKBP14
9	9606.ENSP00000387654	0.615	Prenylcysteine oxidase 1
10	9606.ENSP00000378046	0.611	Peptidyl-prolyl cis-trans isomerase FKBP2
11	9606.ENSP00000413152	0.607	PPIases accelerate the folding of proteins during protein synthesis
12	9606.ENSP00000464890	0.534	POU domain, class 5, transcription factor 2
13	9606.ENSP00000362183	0.533	Glutamate receptor ionotropic, kainate 3
14	9606.ENSP00000341938	0.517	Sulfatase-modifying factor 2
15	9606.ENSP00000340887	0.501	Uncharacterized protein C5orf47

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.509	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0051252	0.947	regulation of RNA metabolic process
GO:0010468	0.895	regulation of gene expression
GO:0048856	0.887	anatomical structure development
GO:0043484	0.867	regulation of RNA splicing
GO:1903311	0.676	regulation of mRNA metabolic process
GO:0050684	0.647	regulation of mRNA processing
GO:0048024	0.606	regulation of mRNA splicing, via spliceosome
GO:0000381	0.581	regulation of alternative mRNA splicing, via spliceosome
GO:0008152	0.340	metabolic process
GO:0044237	0.329	cellular metabolic process
GO:0044238	0.311	primary metabolic process
GO:0071704	0.310	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005634	0.919	nucleus
GO:0070013	0.530	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]