StarFunc result for job id Q8WUH1

User Input

>input (139 residues)
MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVC
SKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGK
AEDTISILPDDPRQMTLLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WUH1	1.000	1.000	9.782E-27	139	1.000	1.000	Q8WUH1.pdb.gz	CHUR_HUMAN Protein Churchill OS=Homo sapiens OX=9606 GN=CHURC1 PE=1 SV=3
2	AFDB:Q5U3N7	0.796	0.985	2.732E-18	112	0.561	0.696	Q5U3N7.pdb.gz	CHUR_DANRE Protein Churchill OS=Danio rerio OX=7955 GN=churc1 PE=2 SV=1
3	PDB:2joxA	0.694	0.900	5.270E-17	106	0.763	1.000	2joxA.pdb.gz	Embryonic Neural Inducing Factor Churchill Is not a DNA-binding Zinc Finger Protein: Solution Structure Reveals a Solvent-exposed beta-Sheet and Zinc Binuclear Cluster
4	AFDB:Q8GW56	0.224	0.085	6.744E-2	422	0.050	0.017	Q8GW56.pdb.gz	Q8GW56_ARATH At2g03640 OS=Arabidopsis thaliana OX=3702 GN=At2g03640 PE=1 SV=1
5	AFDB:I1MBG9	0.198	0.098	1.199E-1	332	0.079	0.033	I1MBG9.pdb.gz	I1MBG9_SOYBN WRKY domain-containing protein OS=Glycine max OX=3847 GN=GLYMA_14G199800 PE=4 SV=1
6	AFDB:P10252	0.207	0.129	1.425E-1	240	0.065	0.037	P10252.pdb.gz	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
7	AFDB:Q9LMX6	0.244	0.092	1.509E-1	428	0.029	0.009	Q9LMX6.pdb.gz	Q9LMX6_ARATH At1g13730 OS=Arabidopsis thaliana OX=3702 GN=At1g13730 PE=1 SV=1
8	AFDB:O45285	0.347	0.135	2.258E-1	377	0.058	0.021	O45285.pdb.gz	O45285_CAEEL F-box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fbxa-167 PE=1 SV=1
9	AFDB:P15791	0.188	0.058	2.392E-1	533	0.058	0.015	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
10	PDB:7enaq	0.242	0.080	2.452E-1	555	0.050	0.013	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
11	AFDB:O17468	0.168	0.038	2.683E-1	1047	0.122	0.016	O17468.pdb.gz	HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster OX=7227 GN=Hira PE=1 SV=2
12	AFDB:Q9JK92	0.209	0.158	2.683E-1	196	0.187	0.133	Q9JK92.pdb.gz	HSPB8_MOUSE Heat shock protein beta-8 OS=Mus musculus OX=10090 GN=Hspb8 PE=1 SV=1
13	PDB:1uliD	0.117	0.100	2.751E-1	178	0.072	0.056	1uliD.pdb.gz	Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
14	PDB:3ff0A	0.128	0.114	3.669E-1	162	0.050	0.043	3ff0A.pdb.gz
15	PDB:1iznA	0.294	0.167	4.360E-1	275	0.086	0.044	1iznA.pdb.gz
16	PDB:8h11B	0.125	0.024	5.181E-1	992	0.101	0.014	8h11B.pdb.gz
17	PDB:8h16A	0.216	0.049	5.181E-1	805	0.079	0.014	8h16A.pdb.gz
18	PDB:3hw2A	0.172	0.098	5.488E-1	308	0.101	0.045	3hw2A.pdb.gz
19	PDB:6vxxA	0.129	0.030	5.488E-1	972	0.079	0.011	6vxxA.pdb.gz
20	PDB:6qleP	0.184	0.116	5.813E-1	242	0.058	0.033	6qleP.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WUH1	4.95e-81	235	112	0.806	1.000	CHUR_HUMAN Protein Churchill OS=Homo sapiens OX=9606 GN=CHURC1 PE=1 SV=3
2	Q5U3N7	5.10e-59	180	112	0.561	0.696	CHUR_DANRE Protein Churchill OS=Danio rerio OX=7955 GN=churc1 PE=2 SV=1
3	W0SKS3	2.3	30.0	400	0.187	0.065	U6DT_PETCR Umbelliferone 6-dimethylallyltransferase, chloroplastic OS=Petroselinum crispum OX=4043 GN=PcPT PE=1 SV=1
4	F1QNZ8	9.5	28.5	910	0.165	0.025	F1QNZ8_DANRE Anoctamin OS=Danio rerio OX=7955 GN=ano6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06573 Churchill	1.1e-53	191.7	Churchill protein
2	PF17026 zf-RRPl_C4	23	16.5	Putative ribonucleoprotein zinc-finger pf C4 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000006713

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000006718	0.702	Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
2	9601.ENSPPYP00000011172	0.699	Fc fragment of IgG binding protein
3	9601.ENSPPYP00000023797	0.699	Uncharacterized protein
4	9601.ENSPPYP00000023579	0.645	Protocadherin 17
5	9601.ENSPPYP00000006946	0.634	Alpha-1-antichymotrypsin
6	9601.ENSPPYP00000003503	0.592	Neuronal PAS domain protein 4
7	9601.ENSPPYP00000014323	0.569	Uncharacterized protein
8	9601.ENSPPYP00000014079	0.566	Uncharacterized protein
9	9601.ENSPPYP00000018927	0.557	Peptidylprolyl isomerase (cyclophilin)-like 6
10	9601.ENSPPYP00000002025	0.536	Complement component 1, q subcomponent, C chain
11	9601.ENSPPYP00000018450	0.523	Major histocompatibility complex, class II, DO alpha
12	9601.ENSPPYP00000019534	0.523	Zonadhesin (gene/pseudogene)
13	9601.ENSPPYP00000010408	0.514	Outer dense fiber of sperm tails 3-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048523	0.980	negative regulation of cellular process
GO:0009987	0.966	cellular process
GO:0048583	0.776	regulation of response to stimulus
GO:0050896	0.669	response to stimulus
GO:0048518	0.498	positive regulation of biological process
GO:0019222	0.498	regulation of metabolic process
GO:0060255	0.493	regulation of macromolecule metabolic process
GO:0048522	0.481	positive regulation of cellular process
GO:0031323	0.479	regulation of cellular metabolic process
GO:0009966	0.479	regulation of signal transduction
GO:0022603	0.452	regulation of anatomical structure morphogenesis
GO:0010468	0.437	regulation of gene expression
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0080090	0.405	regulation of primary metabolic process
GO:0032501	0.379	multicellular organismal process
GO:0051252	0.374	regulation of RNA metabolic process
GO:0032502	0.368	developmental process
GO:0007275	0.357	multicellular organism development
GO:0040012	0.352	regulation of locomotion
GO:0030336	0.333	negative regulation of cell migration
GO:0051716	0.332	cellular response to stimulus
GO:0045595	0.323	regulation of cell differentiation
GO:0071495	0.317	cellular response to endogenous stimulus
GO:0009968	0.316	negative regulation of signal transduction
GO:0042074	0.310	cell migration involved in gastrulation
GO:0007389	0.305	pattern specification process
GO:0023052	0.302	signaling
GO:0007154	0.301	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.981	nucleoplasm
GO:0005737	0.879	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]