StarFunc result for job id Q8WUH2

User Input

>input (860 residues)
MMSIKAFTLVSAVERELLMGDKERVNIECVECCGRDLYVGTNDCFVYHFLLEERPVPAGP
ATFTATKQLQRHLGFKKPVNELRAASALNRLLVLCDNSISLVNMLNLEPVPSGARIKGAA
TFALNENPVSGDPFCVEVCIISVKRRTIQMFLVYEDRVQIVKEVSTAEQPLAVAVDGHFL
CLALTTQYIIHNYSTGVSQDLFPYCSEERPPIVKRIGRQEFLLAGPGGLGMFATVAGISQ
RAPVHWSENVIGAAVSFPYVIALDDEFITVHSMLDQQQKQTLPFKEGHILQDFEGRVIVA
TSKGVYILVPLPLEKQIQDLLASRRVEEALVLAKGARRNIPKEKFQVMYRRILQQAGFIQ
FAQLQFLEAKELFRSGQLDVRELISLYPFLLPTSSSFTRSHPPLHEYADLNQLTQGDQEK
MAKCKRFLMSYLNEVRSTEVANGYKEDIDTALLKLYAEADHDSLLDLLVTENFCLLTDSA
AWLEKHKKYFALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEE
LVWAYADWVLQKSEEVGVQVFTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVID
KRLQKEEYHTHLAVLYLEEVLLQRASASGKGAEATETQAKLRRLLQKSDLYRVHFLLERL
QGAGLPMESAILHGKLGEHEKALHILVHELQDFAAAEDYCLWCSEGRDPPHRQQLFHTLL
AIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTWSVQLLCPFLMGAMRDSIHA
RRTMQVALGLARSENLIYTYDKMKLKGSSIQLSDKKLCQICQNPFCEPVFVRYPNGGLVH
THCAASRHTNPSSSSPGTRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UR70	0.853	0.853	0.000	860	0.893	0.893	Q3UR70.pdb.gz	TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tgfbrap1 PE=1 SV=1
2	AFDB:Q8WUH2	1.000	1.000	0.000	860	1.000	1.000	Q8WUH2.pdb.gz	TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TGFBRAP1 PE=1 SV=1
3	AFDB:F1RCV6	0.584	0.576	1.735E-45	875	0.245	0.241	F1RCV6.pdb.gz
4	AFDB:Q8R5L3	0.577	0.564	2.895E-44	886	0.236	0.229	Q8R5L3.pdb.gz	VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus OX=10090 GN=Vps39 PE=1 SV=1
5	AFDB:Q9VEA2	0.414	0.408	1.544E-41	876	0.224	0.220	Q9VEA2.pdb.gz	Q9VEA2_DROME GH10703p OS=Drosophila melanogaster OX=7227 GN=Vps39 PE=2 SV=1
6	AFDB:Q1ZXS5	0.449	0.423	6.973E-40	926	0.228	0.212	Q1ZXS5.pdb.gz	VPS39_CAEEL Vacuolar protein sorting-associated protein 39 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-39 PE=1 SV=1
7	AFDB:C8V1V7	0.527	0.431	1.576E-38	1124	0.227	0.173	C8V1V7.pdb.gz	C8V1V7_EMENI AvaB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10849 PE=4 SV=1
8	AFDB:O13955	0.449	0.432	1.059E-37	905	0.184	0.175	O13955.pdb.gz	VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vam6 PE=3 SV=1
9	AFDB:Q8L5Y0	0.558	0.489	1.059E-37	1000	0.256	0.220	Q8L5Y0.pdb.gz	VPS39_ARATH Vacuolar sorting protein 39 OS=Arabidopsis thaliana OX=3702 GN=VPS39 PE=1 SV=1
10	AFDB:F4I312	0.693	0.617	1.767E-36	984	0.216	0.189	F4I312.pdb.gz	VPS3_ARATH Vacuolar sorting protein 3 OS=Arabidopsis thaliana OX=3702 GN=VPS3 PE=1 SV=2
11	PDB:7zu0A	0.435	0.399	2.801E-15	954	0.159	0.144	7zu0A.pdb.gz
12	PDB:1xi4A	0.265	0.151	3.679E-11	1630	0.137	0.072	1xi4A.pdb.gz
13	PDB:7zu0C	0.218	0.221	8.747E-11	842	0.108	0.110	7zu0C.pdb.gz
14	PDB:7zu0B	0.249	0.285	1.991E-10	733	0.103	0.121	7zu0B.pdb.gz
15	PDB:7qpgR	0.260	0.115	2.080E-10	2208	0.144	0.056	7qpgR.pdb.gz
16	PDB:7d5sB2	0.210	0.212	8.313E-10	851	0.076	0.076	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:6ttuT	0.262	0.539	9.065E-10	394	0.041	0.089	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
18	PDB:6qk7A	0.210	0.169	9.466E-10	1161	0.121	0.090	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
19	PDB:6nd4Q	0.219	0.218	1.227E-9	862	0.080	0.080	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
20	PDB:7wb4j	0.238	0.210	1.812E-9	995	0.108	0.093	7wb4j.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UR70	0.0	1617	860	0.893	0.893	TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tgfbrap1 PE=1 SV=1
2	Q8WUH2	0.0	1785	860	1.000	1.000	TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TGFBRAP1 PE=1 SV=1
3	B0EXK3	4.87e-55	207	875	0.264	0.259	B0EXK3_DANRE Vesicle fusion protein OS=Danio rerio OX=7955 GN=vps39 PE=2 SV=1
4	A0A0G2KA50	5.72e-53	201	884	0.251	0.244	A0A0G2KA50_RAT VPS39 subunit of HOPS complex OS=Rattus norvegicus OX=10116 GN=Vps39 PE=1 SV=2
5	E9PT04	7.50e-53	201	873	0.251	0.247	E9PT04_RAT VPS39 subunit of HOPS complex OS=Rattus norvegicus OX=10116 GN=Vps39 PE=1 SV=2
6	A0A8I5ZMY7	2.80e-52	199	851	0.238	0.241	A0A8I5ZMY7_RAT VPS39 subunit of HOPS complex OS=Rattus norvegicus OX=10116 GN=Vps39 PE=1 SV=1
7	Q96JC1	3.66e-52	199	886	0.259	0.252	VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens OX=9606 GN=VPS39 PE=1 SV=2
8	Q8R5L3	2.16e-51	196	886	0.255	0.247	VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus OX=10090 GN=Vps39 PE=1 SV=1
9	Q9VEA2	1.25e-40	163	876	0.245	0.241	Q9VEA2_DROME GH10703p OS=Drosophila melanogaster OX=7227 GN=Vps39 PE=2 SV=1
10	A0A8I6A3C4	5.96e-37	152	851	0.241	0.243	A0A8I6A3C4_RAT VPS39 subunit of HOPS complex OS=Rattus norvegicus OX=10116 GN=Vps39 PE=1 SV=1
11	Q1ZXS5	5.84e-34	142	926	0.197	0.183	VPS39_CAEEL Vacuolar protein sorting-associated protein 39 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-39 PE=1 SV=1
12	F4I312	7.01e-30	130	984	0.199	0.174	VPS3_ARATH Vacuolar sorting protein 3 OS=Arabidopsis thaliana OX=3702 GN=VPS3 PE=1 SV=2
13	Q8L5Y0	8.13e-24	110	1000	0.228	0.196	VPS39_ARATH Vacuolar sorting protein 39 OS=Arabidopsis thaliana OX=3702 GN=VPS39 PE=1 SV=1
14	C8V1V7	6.22e-22	104	1124	0.120	0.092	C8V1V7_EMENI AvaB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10849 PE=4 SV=1
15	O13955	1.57e-19	96.7	905	0.177	0.168	VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vam6 PE=3 SV=1
16	Q5PQS9	1.52e-18	92.0	492	0.115	0.201	Q5PQS9_RAT Vps39 protein OS=Rattus norvegicus OX=10116 GN=Vps39 PE=2 SV=1
17	A0A1D8PGN0	2.91e-12	73.2	1034	0.095	0.079	A0A1D8PGN0_CANAL CNH domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAM6 PE=4 SV=1
18	Q07468	6.32e-10	65.5	1049	0.084	0.069	VAM6_YEAST Vacuolar morphogenesis protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAM6 PE=1 SV=1
19	A0A8I6AL66	5.64e-07	55.5	459	0.113	0.211	A0A8I6AL66_RAT VPS39 subunit of HOPS complex OS=Rattus norvegicus OX=10116 GN=Vps39 PE=1 SV=1
20	O59796	9.29e-06	52.0	910	0.180	0.170	VPS3_SCHPO Vacuolar protein sorting-associated protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps3 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00637 Clathrin	2e-13	61.9	Region in Clathrin and VPS
2	PF00780 CNH	6.8e-10	50.8	CNH domain
3	PF10366 Vps39_1	6.2e-21	86.1	Vacuolar sorting protein 39 domain 1
4	PF10367 Vps39_2	5.9e-28	108.8	Vacuolar sorting protein 39 domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220509	0.999	Vacuolar protein sorting-associated protein 18 homolog
2	9606.ENSP00000404704	0.999	Vacuolar protein sorting-associated protein 8 homolog
3	9606.ENSP00000481126	0.999	Vacuolar protein sorting-associated protein 11 homolog
4	9606.ENSP00000369810	0.998	Vacuolar protein sorting-associated protein 16 homolog
5	9606.ENSP00000309457	0.997	Vacuolar protein sorting-associated protein 41 homolog
6	9606.ENSP00000341551	0.990	Mothers against decapentaplegic homolog 4
7	9606.ENSP00000364133	0.969	TGF-beta receptor type-1
8	9606.ENSP00000335193	0.965	Vam6/Vps39-like protein
9	9606.ENSP00000265062	0.961	Ras-related protein Rab-7a
10	9606.ENSP00000267199	0.960	Vacuolar protein sorting-associated protein 33A
11	9606.ENSP00000351905	0.957	TGF-beta receptor type-2
12	9606.ENSP00000262160	0.942	Mothers against decapentaplegic homolog 2
13	9606.ENSP00000273047	0.941	Ras-related protein Rab-5A
14	9606.ENSP00000212355	0.931	Transforming growth factor beta receptor type 3
15	9606.ENSP00000327650	0.913	Vacuolar protein sorting-associated protein 33B
16	9606.ENSP00000238682	0.908	Transforming growth factor beta-3
17	9606.ENSP00000221930	0.906	Transforming growth factor beta-1
18	9606.ENSP00000358126	0.842	Vacuolar protein sorting-associated protein 45
19	9606.ENSP00000479762	0.798	Ras-related protein Rab-7b
20	9606.ENSP00000331901	0.793	Elongation factor 1-gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046332	0.992	SMAD binding
GO:0005160	0.992	transforming growth factor beta receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006906	0.986	vesicle fusion
GO:0046907	0.983	intracellular transport
GO:0050789	0.979	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0007041	0.933	lysosomal transport
GO:0050896	0.915	response to stimulus
GO:0019222	0.882	regulation of metabolic process
GO:0031323	0.823	regulation of cellular metabolic process
GO:0051716	0.795	cellular response to stimulus
GO:0080090	0.759	regulation of primary metabolic process
GO:0060255	0.752	regulation of macromolecule metabolic process
GO:0051171	0.709	regulation of nitrogen compound metabolic process
GO:0007154	0.680	cell communication
GO:0008333	0.593	endosome to lysosome transport
GO:0007178	0.503	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071560	0.486	cellular response to transforming growth factor beta stimulus
GO:0007179	0.473	transforming growth factor beta receptor signaling pathway
GO:0010468	0.466	regulation of gene expression
GO:0009889	0.457	regulation of biosynthetic process
GO:0019219	0.455	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.454	regulation of macromolecule biosynthetic process
GO:0031326	0.450	regulation of cellular biosynthetic process
GO:2001141	0.425	regulation of RNA biosynthetic process
GO:1903506	0.424	regulation of nucleic acid-templated transcription
GO:0006355	0.408	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0032991	0.978	protein-containing complex
GO:0016020	0.975	membrane
GO:0031090	0.932	organelle membrane
GO:0099023	0.585	vesicle tethering complex
GO:0005769	0.508	early endosome
GO:0005829	0.350	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]