StarFunc result for job id Q8WUI4

User Input

>input (952 residues)
MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPL
ETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
LPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRI
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KPH8	0.411	0.387	0.000	1014	0.945	0.888	J3KPH8.pdb.gz	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
2	PDB:5eduB	0.350	0.458	2.617E-39	723	0.179	0.235	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
3	PDB:6z6fB	0.350	0.498	2.269E-36	661	0.160	0.230	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
4	PDB:7sggA	0.359	0.526	1.358E-35	644	0.139	0.205	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
5	PDB:6uijA	0.358	0.545	8.995E-34	620	0.143	0.219	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
6	PDB:5ikkA	0.318	0.502	4.304E-33	594	0.148	0.237	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
7	PDB:5g0yB	0.332	0.799	4.886E-29	377	0.113	0.286	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
8	PDB:7zzuB	0.314	0.770	9.504E-23	371	0.088	0.226	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
9	PDB:4qa0A	0.309	0.752	6.360E-22	371	0.084	0.216	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
10	PDB:3sfhA	0.292	0.774	3.806E-21	342	0.083	0.231	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
11	AFDB:Q8IJW3	0.317	0.131	8.042E-18	2379	0.159	0.063	Q8IJW3.pdb.gz	Q8IJW3_PLAF7 Histone deacetylase 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1008000 PE=3 SV=1
12	PDB:6ss2AAA	0.199	0.496	1.462E-4	320	0.048	0.144	6ss2AAA.pdb.gz	Structural and functional characterization of C0021158, a high-affinity monoclonal antibody that inhibits Arginase 2 function via a novel non-competitive mechanism of action.
13	AFDB:Q9UU99	0.057	0.057	5.458E-2	1008	0.141	0.133	Q9UU99.pdb.gz	YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC23B6.04c PE=1 SV=1
14	AFDB:Q6ZUT6	0.042	0.068	8.537E-2	534	0.099	0.176	Q6ZUT6.pdb.gz	CCD9B_HUMAN Coiled-coil domain-containing protein 9B OS=Homo sapiens OX=9606 GN=CCDC9B PE=1 SV=1
15	AFDB:Q9SLF3	0.097	0.080	1.068E-1	1206	0.122	0.096	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
16	AFDB:Q22308	0.129	0.122	1.263E-1	1022	0.121	0.113	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2
17	AFDB:Q9H3S7	0.081	0.057	1.412E-1	1636	0.158	0.092	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
18	AFDB:F1RBK4	0.069	0.061	3.454E-1	1216	0.143	0.112	F1RBK4.pdb.gz
19	AFDB:Q9Y794	0.104	0.103	3.454E-1	972	0.133	0.131	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
20	AFDB:P54674	0.035	0.022	3.653E-1	1857	0.090	0.046	P54674.pdb.gz	PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum OX=44689 GN=pikB PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K082	0.0	606	1043	0.432	0.394	A0A0G2K082_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=2
2	A0A0R4IAH0	0.0	745	1052	0.479	0.433	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
3	A0A8I5XW09	0.0	627	1089	0.318	0.278	A0A8I5XW09_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
4	A0A8I5ZWP6	0.0	585	1024	0.348	0.323	A0A8I5ZWP6_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=1
5	A0A8I6G4R8	0.0	627	1114	0.318	0.272	A0A8I6G4R8_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
6	E5RQ38	0.0	624	1068	0.437	0.390	E5RQ38_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
7	E7FH14	0.0	703	1128	0.471	0.397	E7FH14_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=hdac5 PE=3 SV=2
8	F1LM64	0.0	671	970	0.439	0.431	F1LM64_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=1 SV=4
9	J3KPH8	0.0	1787	1014	0.936	0.879	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
10	P56524	0.0	804	1084	0.512	0.449	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
11	P83038	0.0	812	1080	0.519	0.457	HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus OX=9031 GN=HDAC4 PE=2 SV=1
12	Q08BS8	0.0	745	1023	0.476	0.443	Q08BS8_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=zgc:152701 PE=1 SV=1
13	Q6NZM9	0.0	776	1076	0.507	0.449	HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus OX=10090 GN=Hdac4 PE=1 SV=1
14	Q8C2B3	0.0	1585	938	0.861	0.874	HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus OX=10090 GN=Hdac7 PE=1 SV=2
15	Q8WUI4	0.0	1917	952	1.000	1.000	HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=2
16	Q99P99	0.0	773	1077	0.507	0.448	HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus OX=10116 GN=Hdac4 PE=1 SV=2
17	Q9UKV0	0.0	613	1011	0.423	0.399	HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens OX=9606 GN=HDAC9 PE=1 SV=2
18	Q9UQL6	0.0	624	1122	0.316	0.268	HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens OX=9606 GN=HDAC5 PE=1 SV=2
19	Q9Z2V6	0.0	625	1113	0.318	0.272	HDAC5_MOUSE Histone deacetylase 5 OS=Mus musculus OX=10090 GN=Hdac5 PE=1 SV=2
20	E5RQ39	4.52e-180	548	934	0.321	0.328	E5RQ39_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00850 Hist_deacetyl	5.1e-80	280.7	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000080059

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.979	Histone acetyltransferase p300
2	9606.ENSP00000384018	0.979	Nuclear receptor corepressor 2
3	9606.ENSP00000437955	0.979	Hypoxia-inducible factor 1-alpha
4	9606.ENSP00000302967	0.975	Histone deacetylase 3
5	9606.ENSP00000340330	0.975	Histone acetyltransferase KAT5
6	9606.ENSP00000268058	0.967	Protein PML
7	9606.ENSP00000346389	0.967	Myocyte-specific enhancer factor 2A
8	9606.ENSP00000405330	0.960	Estrogen receptor
9	9606.ENSP00000348056	0.957	SUMO-conjugating enzyme UBC9
10	9606.ENSP00000363822	0.951	Androgen receptor
11	9606.ENSP00000262367	0.949	CREB-binding protein
12	9606.ENSP00000268712	0.940	Nuclear receptor corepressor 1
13	9606.ENSP00000358151	0.937	Histone H2B type 2-E
14	9606.ENSP00000332194	0.936	Histone H2A type 2-C
15	9606.ENSP00000376077	0.921	Small ubiquitin-related modifier 1
16	9606.ENSP00000351407	0.908	Aryl hydrocarbon receptor nuclear translocator
17	9606.ENSP00000444198	0.902	Cbp/p300-interacting transactivator 2
18	9606.ENSP00000292599	0.894	Mastermind-like protein 1
19	9606.ENSP00000360493	0.873	Runt-related transcription factor 2
20	9606.ENSP00000365380	0.873	Forkhead box protein P3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0004407	0.996	histone deacetylase activity
GO:0019899	0.490	enzyme binding
GO:0140110	0.445	transcription regulator activity
GO:0097159	0.394	organic cyclic compound binding
GO:1901363	0.393	heterocyclic compound binding
GO:0003676	0.377	nucleic acid binding
GO:0003677	0.310	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0032501	0.962	multicellular organismal process
GO:0071704	0.961	organic substance metabolic process
GO:0048856	0.957	anatomical structure development
GO:0051239	0.957	regulation of multicellular organismal process
GO:0044238	0.945	primary metabolic process
GO:0050793	0.929	regulation of developmental process
GO:0010468	0.927	regulation of gene expression
GO:0006355	0.904	regulation of DNA-templated transcription
GO:0048518	0.901	positive regulation of biological process
GO:0048523	0.900	negative regulation of cellular process
GO:0006807	0.891	nitrogen compound metabolic process
GO:0043170	0.886	macromolecule metabolic process
GO:0010605	0.877	negative regulation of macromolecule metabolic process
GO:0050896	0.854	response to stimulus
GO:0048583	0.825	regulation of response to stimulus
GO:0048522	0.809	positive regulation of cellular process
GO:0023051	0.801	regulation of signaling
GO:0010646	0.801	regulation of cell communication
GO:0019538	0.796	protein metabolic process
GO:0036211	0.790	protein modification process
GO:0098732	0.763	macromolecule deacylation
GO:0040012	0.753	regulation of locomotion
GO:0048869	0.713	cellular developmental process
GO:0010594	0.691	regulation of endothelial cell migration
GO:0043535	0.682	regulation of blood vessel endothelial cell migration
GO:0031324	0.674	negative regulation of cellular metabolic process
GO:0051241	0.656	negative regulation of multicellular organismal process
GO:0006476	0.626	protein deacetylation
GO:0009966	0.563	regulation of signal transduction
GO:0051172	0.522	negative regulation of nitrogen compound metabolic process
GO:0071840	0.521	cellular component organization or biogenesis
GO:0006357	0.502	regulation of transcription by RNA polymerase II
GO:0009890	0.493	negative regulation of biosynthetic process
GO:0045934	0.490	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.476	negative regulation of cellular biosynthetic process
GO:0016043	0.473	cellular component organization
GO:0051253	0.470	negative regulation of RNA metabolic process
GO:0009893	0.456	positive regulation of metabolic process
GO:0045892	0.453	negative regulation of DNA-templated transcription
GO:0007275	0.441	multicellular organism development
GO:0090049	0.440	regulation of cell migration involved in sprouting angiogenesis
GO:1901222	0.432	regulation of NIK/NF-kappaB signaling
GO:0051093	0.424	negative regulation of developmental process
GO:0010604	0.421	positive regulation of macromolecule metabolic process
GO:0051716	0.416	cellular response to stimulus
GO:0032663	0.410	regulation of interleukin-2 production
GO:0051173	0.405	positive regulation of nitrogen compound metabolic process
GO:0030154	0.404	cell differentiation
GO:0031325	0.392	positive regulation of cellular metabolic process
GO:0000122	0.379	negative regulation of transcription by RNA polymerase II
GO:0006325	0.354	chromatin organization
GO:0048731	0.347	system development
GO:0045595	0.318	regulation of cell differentiation
GO:0018205	0.314	peptidyl-lysine modification
GO:0044237	0.313	cellular metabolic process
GO:0006950	0.303	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.991	cytosol
GO:0032991	0.980	protein-containing complex
GO:1902494	0.740	catalytic complex
GO:0140513	0.660	nuclear protein-containing complex
GO:0043232	0.376	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	0.996	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	0.996	histone deacetylase.

[back to server]