StarFunc result for job id Q8WUJ0

User Input

>input (223 residues)
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGTTGSLKRTHEEEDDFGTMQVATAQNG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R641	0.897	0.897	6.341E-42	223	1.000	1.000	A0A024R641.pdb.gz
2	AFDB:Q55E39	0.602	0.632	1.375E-16	212	0.274	0.288	Q55E39.pdb.gz	DUSP1_DICDI Probable dual specificity protein phosphatase DDB_G0269404 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269404 PE=3 SV=1
3	AFDB:P28562	0.610	0.374	1.463E-16	367	0.265	0.161	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
4	AFDB:A0A2R8QPP3	0.637	0.395	2.555E-16	367	0.296	0.180	A0A2R8QPP3.pdb.gz
5	AFDB:Q556Y8	0.643	0.311	2.892E-16	476	0.256	0.120	Q556Y8.pdb.gz	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
6	AFDB:Q6NN85	0.641	0.142	2.892E-16	1045	0.242	0.052	Q6NN85.pdb.gz	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
7	AFDB:Q99956	0.612	0.359	3.077E-16	384	0.278	0.161	Q99956.pdb.gz	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
8	AFDB:Q91790	0.616	0.377	3.273E-16	369	0.269	0.163	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
9	AFDB:Q9ESS0	0.636	0.301	4.746E-16	483	0.247	0.114	Q9ESS0.pdb.gz	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
10	AFDB:O09112	0.651	0.226	5.372E-16	663	0.283	0.095	O09112.pdb.gz	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
11	PDB:6d66A	0.621	0.271	2.423E-15	517	0.247	0.106	6d66A.pdb.gz
12	PDB:2wgpA	0.583	0.765	3.475E-14	168	0.242	0.321	2wgpA.pdb.gz
13	PDB:2esbA	0.606	0.826	3.437E-13	162	0.175	0.241	2esbA.pdb.gz
14	PDB:5y15A	0.594	0.882	6.384E-13	148	0.184	0.277	5y15A.pdb.gz
15	PDB:2gwoC	0.567	0.716	7.687E-13	174	0.224	0.287	2gwoC.pdb.gz
16	PDB:3f81A	0.613	0.755	9.154E-12	179	0.215	0.268	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
17	PDB:2y96A	0.577	0.725	5.868E-11	175	0.206	0.263	2y96A.pdb.gz
18	PDB:5xjvB	0.569	0.733	7.518E-11	171	0.220	0.287	5xjvB.pdb.gz
19	PDB:4ercA	0.513	0.743	5.335E-8	150	0.121	0.180	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
20	PDB:2q05A	0.508	0.614	1.270E-7	181	0.121	0.149	2q05A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WUJ0	4.14e-170	468	223	1.000	1.000	STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens OX=9606 GN=STYX PE=1 SV=1
2	Q60969	1.14e-165	457	223	0.964	0.964	STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus OX=10090 GN=Styx PE=1 SV=2
3	Q9NRW4	2.78e-24	97.1	184	0.247	0.299	DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens OX=9606 GN=DUSP22 PE=1 SV=1
4	Q55E39	7.93e-24	96.7	212	0.260	0.274	DUSP1_DICDI Probable dual specificity protein phosphatase DDB_G0269404 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269404 PE=3 SV=1
5	Q99N11	1.08e-23	95.5	184	0.238	0.288	DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus OX=10090 GN=Dusp22 PE=1 SV=1
6	Q8K4T5	2.63e-23	95.1	220	0.242	0.245	DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus OX=10090 GN=Dusp19 PE=2 SV=1
7	Q8WTR2	3.92e-23	94.7	217	0.238	0.244	DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens OX=9606 GN=DUSP19 PE=1 SV=1
8	Q05923	4.42e-23	96.7	314	0.274	0.194	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
9	Q7SZF3	1.05e-22	96.3	367	0.269	0.163	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
10	Q586U9	3.00e-22	96.7	1042	0.242	0.052	Q586U9_TRYB2 Dual specificity protein phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.490 PE=4 SV=1
11	O09112	3.20e-22	96.7	663	0.251	0.084	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
12	Q586S8	3.71e-22	94.0	302	0.238	0.175	Q586S8_TRYB2 Dual specificity protein phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.145 PE=4 SV=1
13	Q9M8K7	3.89e-22	90.9	167	0.224	0.299	DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana OX=3702 GN=DSPTP1B PE=1 SV=1
14	Q9ZR37	1.24e-21	90.5	198	0.224	0.253	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
15	Q6NN85	1.35e-21	94.7	1045	0.247	0.053	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
16	Q91790	3.25e-21	92.4	369	0.265	0.160	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
17	P28562	4.44e-21	92.0	367	0.265	0.161	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
18	A0A8I6ATT8	7.42e-21	92.8	1423	0.238	0.037	A0A8I6ATT8_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=1
19	Q556Y8	7.85e-21	92.0	476	0.202	0.095	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
20	F1M4Q5	8.17e-21	92.4	1430	0.238	0.037	F1M4Q5_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	3.1e-34	129.1	Dual specificity phosphatase, catalytic domain
2	PF00102 Y_phosphatase	1.6e+02	13.3	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302485	0.749	Cold shock domain-containing protein C2
2	9606.ENSP00000281741	0.716	Thioredoxin domain containing 16
3	9606.ENSP00000342105	0.686	Dual specificity tyrosine-phosphorylation-regulated kinase 2
4	9606.ENSP00000295718	0.671	Receptor-type tyrosine-protein phosphatase-like N
5	9606.ENSP00000281708	0.661	F-box/WD repeat-containing protein 7
6	9606.ENSP00000315106	0.631	Integral membrane protein GPR137C
7	9606.ENSP00000379838	0.552	Calcium-regulated heat-stable protein 1
8	9606.ENSP00000360485	0.546	A-kinase anchor protein 14
9	9606.ENSP00000370527	0.541	Calcipressin-1
10	9606.ENSP00000216286	0.502	Nidogen-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0008138	0.634	protein tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0048519	0.972	negative regulation of biological process
GO:0048523	0.957	negative regulation of cellular process
GO:0060255	0.954	regulation of macromolecule metabolic process
GO:0031323	0.950	regulation of cellular metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0065009	0.937	regulation of molecular function
GO:0048583	0.917	regulation of response to stimulus
GO:0051171	0.909	regulation of nitrogen compound metabolic process
GO:0009966	0.907	regulation of signal transduction
GO:0051246	0.884	regulation of protein metabolic process
GO:1903050	0.853	regulation of proteolysis involved in protein catabolic process
GO:0006810	0.823	transport
GO:0042176	0.814	regulation of protein catabolic process
GO:0009892	0.802	negative regulation of metabolic process
GO:0032501	0.776	multicellular organismal process
GO:0009895	0.764	negative regulation of catabolic process
GO:0045184	0.758	establishment of protein localization
GO:0051649	0.739	establishment of localization in cell
GO:0051169	0.730	nuclear transport
GO:0043393	0.727	regulation of protein binding
GO:0031329	0.705	regulation of cellular catabolic process
GO:0010605	0.696	negative regulation of macromolecule metabolic process
GO:0031324	0.676	negative regulation of cellular metabolic process
GO:1902531	0.662	regulation of intracellular signal transduction
GO:0071705	0.624	nitrogen compound transport
GO:0048518	0.614	positive regulation of biological process
GO:0008152	0.613	metabolic process
GO:1903051	0.587	negative regulation of proteolysis involved in protein catabolic process
GO:0042177	0.544	negative regulation of protein catabolic process
GO:0044237	0.542	cellular metabolic process
GO:0015031	0.542	protein transport
GO:0044092	0.536	negative regulation of molecular function
GO:0061136	0.535	regulation of proteasomal protein catabolic process
GO:2000058	0.535	regulation of ubiquitin-dependent protein catabolic process
GO:0048522	0.532	positive regulation of cellular process
GO:0071704	0.499	organic substance metabolic process
GO:0006913	0.464	nucleocytoplasmic transport
GO:0006807	0.461	nitrogen compound metabolic process
GO:0044238	0.458	primary metabolic process
GO:0032502	0.436	developmental process
GO:1901564	0.424	organonitrogen compound metabolic process
GO:0043170	0.401	macromolecule metabolic process
GO:0050896	0.381	response to stimulus
GO:0019538	0.368	protein metabolic process
GO:0006886	0.363	intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.997	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.990	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]