StarFunc result for job id Q8WUJ3

User Input

>input (1361 residues)
MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHIGQ
GKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNF
TIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFF
ERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEG
SRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVF
KLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPID
IQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN
STILNLEDNVQSWKPGDTLVIASTDYSMYQAEEFQVLPCRSCAPNQVKVAGKPMYLHIGE
EIDGVDMRAEVGLLSRNIIVMGEMEDKCYPYRNHICNFFDFDTFGGHIKFALGFKAAHLE
GTELKHMGQQLVGQYPIHFHLAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLI
KDVVGYNSLGHCFFTEDGPEERNTFDHCLGLLVKSGTLLPSDRDSKMCKMITEDSYPGYI
PKPRQDCNAVSTFWMANPNNNLINCAAAGSEETGFWFIFHHVPTGPSVGMYSPGYSEHIP
LGKFYNNRAHSNYRAGMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDADPLKPREPAI
IRHFIAYKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVG
ESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEG
RHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHD
VDGSVSEYPGSYLTKNDNWLVRHPDCINVPDWRGAICSGCYAQMYIQAYKTSNLRMKIIK
NDFPSHPLYLEGALTRSTHYQQYQPVVTLQKGYTIHWDQTAPAELAIWLINFNKGDWIRV
GLCYPRGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVEQSYPGRSHYYWDEDSGLLFL
KLKAQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAVVDVPMPKKLF
GSQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVVVIDGNQGRVVS
HTSFRNSILQGIPWQLFNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLKLKE
QMAFVGFKGSFRPIWVTLDTEDHKAKIFQVVPIPVVKKKKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KPQ7	0.692	0.684	0.000	1378	0.400	0.396	A3KPQ7.pdb.gz	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
2	AFDB:Q8BI06	0.959	0.959	0.000	1361	0.912	0.912	Q8BI06.pdb.gz	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
3	AFDB:Q9UHN6	0.698	0.688	0.000	1383	0.422	0.415	Q9UHN6.pdb.gz	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
4	AFDB:Q557B8	0.492	0.595	2.511E-33	1106	0.147	0.181	Q557B8.pdb.gz	COMF_DICDI Communication mutant protein F OS=Dictyostelium discoideum OX=44689 GN=comF-1 PE=3 SV=1
5	AFDB:Q92520	0.071	0.407	5.001E-5	227	0.031	0.185	Q92520.pdb.gz	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
6	AFDB:Q9D309	0.072	0.390	5.001E-5	235	0.025	0.145	Q9D309.pdb.gz	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
7	AFDB:Q8WZA1	0.076	0.155	7.528E-5	660	0.033	0.068	Q8WZA1.pdb.gz	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
8	PDB:2yopC	0.067	0.483	9.360E-5	181	0.022	0.166	2yopC.pdb.gz
9	AFDB:P97805	0.097	0.518	1.181E-4	223	0.029	0.175	P97805.pdb.gz	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
10	AFDB:Q96BQ1	0.073	0.428	1.509E-4	224	0.027	0.165	Q96BQ1.pdb.gz	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
11	AFDB:P58499	0.080	0.427	2.180E-4	235	0.024	0.140	P58499.pdb.gz	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
12	PDB:7b7aA	0.084	0.230	1.759E-2	391	0.034	0.118	7b7aA.pdb.gz
13	PDB:5gai0	0.156	0.286	3.672E-2	662	0.041	0.085	5gai0.pdb.gz
14	PDB:7b8bA	0.086	0.202	4.890E-2	369	0.029	0.106	7b8bA.pdb.gz
15	PDB:4kx7A	0.033	0.041	5.759E-2	875	0.015	0.023	4kx7A.pdb.gz	Structural insights into central hypertension regulation by human aminopeptidase a.
16	PDB:5lhdC	0.039	0.052	6.783E-2	905	0.020	0.030	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
17	PDB:6ta5D	0.033	0.091	7.988E-2	345	0.026	0.104	6ta5D.pdb.gz
18	PDB:5iz5A	0.045	0.069	1.886E-1	757	0.018	0.032	5iz5A.pdb.gz
19	PDB:7u9tA	0.046	0.024	5.463E-1	4229	0.022	0.007	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:1ee6A	0.082	0.424	7.274E-1	197	0.020	0.137	1ee6A.pdb.gz	The first structure of pectate lyase belonging to polysaccharide lyase family 3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KPQ7	0.0	860	1378	0.320	0.316	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
2	Q8BI06	0.0	2631	1361	0.913	0.913	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
3	Q8WUJ3	0.0	2846	1361	1.000	1.000	CEMIP_HUMAN Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2
4	Q9UHN6	0.0	886	1383	0.334	0.329	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
5	B4E1B9	7.83e-46	172	376	0.084	0.303	B4E1B9_HUMAN Cell migration inducing hyaluronidase 2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
6	Q80ZA4	1.39e-32	141	4249	0.117	0.037	PKHL1_MOUSE Fibrocystin-L OS=Mus musculus OX=10090 GN=Pkhd1l1 PE=1 SV=1
7	Q86WI1	1.41e-32	141	4243	0.103	0.033	PKHL1_HUMAN Fibrocystin-L OS=Homo sapiens OX=9606 GN=PKHD1L1 PE=2 SV=2
8	Q557B8	2.93e-24	113	1106	0.127	0.156	COMF_DICDI Communication mutant protein F OS=Dictyostelium discoideum OX=44689 GN=comF-1 PE=3 SV=1
9	E9PZ36	9.11e-11	69.7	4059	0.038	0.013	PKHD1_MOUSE Fibrocystin OS=Mus musculus OX=10090 GN=Pkhd1 PE=1 SV=1
10	Q6T3A5	9.11e-11	69.7	4060	0.038	0.013	Q6T3A5_MOUSE PKHD1 OS=Mus musculus OX=10090 GN=Pkhd1 PE=2 SV=1
11	Q91X88	1.52e-10	68.2	660	0.029	0.059	PMGT1_MOUSE Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1
12	Q8WZA1	1.58e-10	68.2	660	0.029	0.059	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
13	Q92520	2.22e-09	61.6	227	0.025	0.150	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
14	E2RK30	2.89e-09	64.7	4074	0.032	0.011	PKHD1_CANLF Fibrocystin OS=Canis lupus familiaris OX=9615 GN=PKHD1 PE=3 SV=2
15	P08F94	3.21e-08	61.2	4074	0.032	0.011	PKHD1_HUMAN Fibrocystin OS=Homo sapiens OX=9606 GN=PKHD1 PE=1 SV=1
16	Q9D309	3.81e-08	58.2	235	0.021	0.119	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
17	A0A0G2K2W1	7.26e-08	60.1	4052	0.032	0.011	A0A0G2K2W1_RAT PKHD1 ciliary IPT domain containing fibrocystin/polyductin OS=Rattus norvegicus OX=10116 GN=Pkhd1 PE=1 SV=2
18	Q96BQ1	1.66e-07	55.8	224	0.021	0.125	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
19	P97805	2.06e-07	55.5	223	0.021	0.130	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
20	P98173	9.11e-06	50.8	230	0.021	0.122	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13229 Beta_helix	9.2	17.6	Right handed beta helix region
2	PF10162 G8	2e-22	90.8	G8 domain
3	PF15711 ILEI	2.6e-37	138.4	Interleukin-like EMT inducer
4	PF13330 Mucin2_WxxW	1.5e-06	40.2	Mucin-2 protein WxxW repeating region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356000	0.857	Plexin-A2
2	9606.ENSP00000313504	0.749	Phosphorylase b kinase regulatory subunit beta
3	9606.ENSP00000363435	0.676	Inositol 1,4,5-trisphosphate receptor type 3
4	9606.ENSP00000266031	0.663	Hyaluronidase-1
5	9606.ENSP00000401853	0.605	Hyaluronidase-2
6	9606.ENSP00000345849	0.601	Hyaluronidase PH-20
7	9606.ENSP00000345629	0.599	Mitogen-activated protein kinase kinase kinase 15
8	9606.ENSP00000306991	0.597	Hyaluronan synthase 2
9	9606.ENSP00000369014	0.538	Protein NDNF
10	9606.ENSP00000462333	0.528	Cytosolic endo-beta-N-acetylglucosaminidase
11	9606.ENSP00000222115	0.527	Hyaluronan synthase 1
12	9606.ENSP00000216962	0.515	Glycogen phosphorylase, brain form
13	9606.ENSP00000376708	0.503	Von Willebrand factor A domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005540	1.000	hyaluronic acid binding
GO:0004415	1.000	hyalurononglucosaminidase activity
GO:0005515	0.966	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.975	metabolic process
GO:0071704	0.940	organic substance metabolic process
GO:0065007	0.922	biological regulation
GO:1903510	0.891	mucopolysaccharide metabolic process
GO:0050789	0.863	regulation of biological process
GO:0050794	0.852	regulation of cellular process
GO:1901565	0.804	organonitrogen compound catabolic process
GO:0009057	0.793	macromolecule catabolic process
GO:1901136	0.777	carbohydrate derivative catabolic process
GO:0006027	0.766	glycosaminoglycan catabolic process
GO:0048518	0.634	positive regulation of biological process
GO:0048522	0.444	positive regulation of cellular process
GO:0009987	0.411	cellular process
GO:0032501	0.398	multicellular organismal process
GO:0030212	0.360	hyaluronan metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0012505	0.998	endomembrane system
GO:0005576	0.993	extracellular region
GO:0005886	0.991	plasma membrane
GO:0030136	0.990	clathrin-coated vesicle
GO:0031090	0.823	organelle membrane
GO:0005615	0.790	extracellular space
GO:0098588	0.723	bounding membrane of organelle
GO:0030659	0.687	cytoplasmic vesicle membrane
GO:0043230	0.617	extracellular organelle
GO:1903561	0.611	extracellular vesicle
GO:0070062	0.575	extracellular exosome
GO:0005783	0.530	endoplasmic reticulum
GO:0070013	0.466	intracellular organelle lumen
GO:0030662	0.363	coated vesicle membrane
GO:0030665	0.348	clathrin-coated vesicle membrane
GO:0030139	0.346	endocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.35	1.000	hyaluronoglucosaminidase.

[back to server]