StarFunc result for job id Q8WUN7

User Input

>input (234 residues)
MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDT
APAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPV
YCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRR
LHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WUN7	1.000	1.000	4.116E-47	234	1.000	1.000	Q8WUN7.pdb.gz	UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBTD2 PE=1 SV=2
2	AFDB:Q9HAC8	0.492	0.505	8.411E-34	227	0.632	0.652	Q9HAC8.pdb.gz	UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBTD1 PE=1 SV=1
3	AFDB:Q5A109	0.347	0.416	9.964E-9	193	0.111	0.135	Q5A109.pdb.gz	RS31_CANAL Ubiquitin-ribosomal protein eS31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI3 PE=1 SV=2
4	AFDB:G2XKQ0	0.309	0.667	2.921E-7	101	0.090	0.208	G2XKQ0.pdb.gz	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
5	PDB:3dbhI	0.316	0.818	4.554E-7	86	0.090	0.244	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
6	AFDB:R9PY16	0.300	0.234	5.077E-7	301	0.090	0.070	R9PY16.pdb.gz	R9PY16_DROME Ubiquitin-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E5 PE=4 SV=1
7	AFDB:P0C016	0.293	0.453	5.398E-7	150	0.094	0.147	P0C016.pdb.gz	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
8	AFDB:O57686	0.319	0.679	6.104E-7	102	0.081	0.186	O57686.pdb.gz	SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis OX=8355 GN=sumo1-a PE=1 SV=1
9	AFDB:Q7SZR5	0.316	0.690	6.104E-7	100	0.094	0.220	Q7SZR5.pdb.gz	SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio OX=7955 GN=sumo1 PE=3 SV=1
10	AFDB:Q9VJ33	0.310	0.820	6.491E-7	84	0.090	0.250	Q9VJ33.pdb.gz	NEDD8_DROME NEDD8 OS=Drosophila melanogaster OX=7227 GN=Nedd8 PE=1 SV=1
11	AFDB:Q9SU29	0.308	0.087	8.298E-7	873	0.145	0.039	Q9SU29.pdb.gz	UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana OX=3702 GN=UPL5 PE=1 SV=1
12	PDB:3ai5A	0.299	0.235	2.542E-6	299	0.085	0.067	3ai5A.pdb.gz
13	PDB:7rbsB	0.307	0.451	5.313E-6	157	0.081	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
14	PDB:5xqmA	0.298	0.712	9.819E-6	90	0.068	0.178	5xqmA.pdb.gz
15	PDB:6ef3u	0.287	0.842	9.819E-6	75	0.090	0.280	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
16	PDB:6mdhA	0.305	0.471	1.509E-5	149	0.064	0.101	6mdhA.pdb.gz
17	PDB:6yvaC	0.301	0.450	1.930E-5	155	0.068	0.103	6yvaC.pdb.gz
18	PDB:3plvA	0.297	0.830	7.925E-5	80	0.056	0.163	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:4pyuA	0.308	0.899	8.427E-5	76	0.038	0.118	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
20	PDB:1wz0A	0.295	0.622	1.873E-4	104	0.056	0.125	1wz0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WUN7	1.76e-178	490	234	1.000	1.000	UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBTD2 PE=1 SV=2
2	B2R886	7.62e-143	399	190	0.812	1.000	B2R886_HUMAN Dendritic cell-derived ubiquitin-like protein, isoform CRA_a OS=Homo sapiens OX=9606 GN=DC-UbP PE=1 SV=1
3	Q9HAC8	2.49e-91	270	227	0.624	0.643	UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBTD1 PE=1 SV=1
4	Q5A109	1.08e-06	49.7	193	0.098	0.119	RS31_CANAL Ubiquitin-ribosomal protein eS31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI3 PE=1 SV=2
5	Q03919	5.15e-06	45.4	77	0.073	0.221	RUB1_YEAST NEDD8-like protein RUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RUB1 PE=1 SV=1
6	P0CH07	1.10e-05	45.8	128	0.090	0.164	RL402_SCHPO Ubiquitin-ribosomal protein eL40B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uep1 PE=1 SV=1
7	P0CH08	1.11e-05	45.8	128	0.090	0.164	RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40A PE=1 SV=1
8	P0CH09	1.11e-05	45.8	128	0.090	0.164	RL40B_YEAST Ubiquitin-ribosomal protein eL40B fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40B PE=1 SV=1
9	Q6FTH4	1.24e-05	45.8	128	0.090	0.164	Q6FTH4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G02475g PE=3 SV=2
10	A2Q831	1.34e-05	45.4	128	0.090	0.164	A2Q831_ASPNC Contig An01c0080, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g02880 PE=3 SV=1
11	P05759	1.44e-05	45.8	152	0.090	0.138	RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPS31 PE=1 SV=3
12	Q6FSS6	1.49e-05	45.8	152	0.090	0.138	Q6FSS6_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G08173g PE=3 SV=1
13	P0C016	1.63e-05	45.8	150	0.090	0.140	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
14	P0C8R3	1.68e-05	45.8	150	0.090	0.140	RS27B_SCHPO Ubiquitin-ribosomal protein eS31B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi5 PE=1 SV=2
15	R9PY16	1.75e-05	47.0	301	0.094	0.073	R9PY16_DROME Ubiquitin-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E5 PE=4 SV=1
16	P62980	1.90e-05	45.8	156	0.090	0.135	RS27A_SOLLC Ubiquitin-ribosomal protein eS31 fusion protein OS=Solanum lycopersicum OX=4081 GN=UBI3 PE=1 SV=2
17	P59232	2.36e-05	45.4	157	0.090	0.134	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
18	P59233	2.87e-05	45.1	157	0.090	0.134	R27AC_ARATH Ubiquitin-ribosomal protein eS31x fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AC PE=2 SV=2
19	Q9SHE7	3.18e-05	45.1	156	0.090	0.135	RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana OX=3702 GN=RUB1 PE=1 SV=3
20	B9DHA6	3.21e-05	44.7	128	0.090	0.164	RL40A_ARATH Ubiquitin-ribosomal protein eL40z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11976 Rad60-SLD	0.00023	32.3	Ubiquitin-2 like Rad60 SUMO-like
2	PF16455 UBD	5.1e-35	131.1	Ubiquitin-binding domain
3	PF00240 ubiquitin	4.9e-09	47.1	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010371620.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010384205.1	0.688	Ubiquitin carboxyl-terminal hydrolase 5 isoform X1
2	61622.XP_010378687.1	0.619	Transmembrane protein 222
3	61622.XP_010364423.1	0.603	Ubiquitin-like modifier-activating enzyme 1 isoform X1
4	61622.XP_010380855.1	0.572	UPF0690 protein C1orf52 homolog isoform X1
5	61622.XP_010372765.1	0.549	Polyadenylate-binding protein 5
6	61622.XP_010382031.1	0.542	FERM and PDZ domain-containing protein 2
7	61622.XP_010364290.1	0.510	Ubiquitin-conjugating enzyme E2 W isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0071704	0.951	organic substance metabolic process
GO:0050789	0.948	regulation of biological process
GO:0044238	0.919	primary metabolic process
GO:0050794	0.889	regulation of cellular process
GO:0006807	0.847	nitrogen compound metabolic process
GO:0050896	0.840	response to stimulus
GO:0043170	0.744	macromolecule metabolic process
GO:1901564	0.695	organonitrogen compound metabolic process
GO:0048518	0.600	positive regulation of biological process
GO:0019538	0.544	protein metabolic process
GO:0019222	0.500	regulation of metabolic process
GO:0044237	0.451	cellular metabolic process
GO:0060255	0.435	regulation of macromolecule metabolic process
GO:0048522	0.400	positive regulation of cellular process
GO:0080090	0.370	regulation of primary metabolic process
GO:0051171	0.353	regulation of nitrogen compound metabolic process
GO:0031323	0.336	regulation of cellular metabolic process
GO:0051246	0.309	regulation of protein metabolic process
GO:0048519	0.305	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0016020	0.987	membrane
GO:0031974	0.816	membrane-enclosed lumen
GO:0070013	0.808	intracellular organelle lumen
GO:0071944	0.780	cell periphery
GO:0031981	0.726	nuclear lumen
GO:0005576	0.620	extracellular region
GO:0070062	0.599	extracellular exosome
GO:0012505	0.536	endomembrane system
GO:0005886	0.525	plasma membrane
GO:0005654	0.440	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]