StarFunc result for job id Q8WUT9

User Input

>input (341 residues)
MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVW
RAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDDLGHISQWSSIMAGSLAGMVS
TIVTYPTDLIKTRLIMQNILEPSYRGLLHAFSTIYQQEGFLALYRGVSLTVVGALPFSAG
SLLVYMNLEKIWNGPRDQFSLPQNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSG
GVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLKIVPYFGIMFSTFEFCKRICLYQNGY
ILSPLSYKLTPGVDQSLQPQELRELKKFFKTRKPKPKKPTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A3V2	0.976	0.976	1.525E-39	341	0.856	0.856	A2A3V2.pdb.gz	S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus OX=10090 GN=Slc25a43 PE=2 SV=1
2	AFDB:Q6I583	0.752	0.724	2.798E-16	355	0.279	0.268	Q6I583.pdb.gz	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
3	AFDB:Q9M058	0.750	0.769	3.168E-16	332	0.273	0.280	Q9M058.pdb.gz	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1
4	AFDB:P29518	0.797	0.631	9.302E-16	436	0.264	0.206	P29518.pdb.gz	BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays OX=4577 GN=BT1 PE=1 SV=1
5	AFDB:Q6NUK1	0.756	0.546	1.098E-15	477	0.229	0.164	Q6NUK1.pdb.gz	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
6	AFDB:Q9SUV1	0.740	0.647	1.408E-15	392	0.252	0.219	Q9SUV1.pdb.gz	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
7	AFDB:F4JHS4	0.728	0.680	3.650E-15	366	0.267	0.249	F4JHS4.pdb.gz	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
8	AFDB:B4F8I5	0.744	0.756	3.804E-15	335	0.252	0.257	B4F8I5.pdb.gz	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
9	AFDB:A0A024R7K2	0.724	0.773	5.084E-15	318	0.238	0.255	A0A024R7K2.pdb.gz
10	AFDB:Q9M024	0.731	0.609	5.084E-15	415	0.246	0.202	Q9M024.pdb.gz	TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TAAC PE=1 SV=1
11	PDB:2c3eA	0.678	0.782	8.438E-11	293	0.217	0.253	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
12	PDB:4c9qB	0.678	0.789	9.959E-11	290	0.208	0.245	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.496	0.561	2.956E-7	292	0.211	0.247	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7p5jA	0.105	0.092	2.667E-1	399	0.138	0.118	7p5jA.pdb.gz
15	PDB:5mkkB	0.167	0.116	2.779E-1	577	0.152	0.090	5mkkB.pdb.gz
16	PDB:5j4nA	0.132	0.110	3.280E-1	437	0.135	0.105	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
17	PDB:7nd2A	0.198	0.202	4.206E-1	330	0.094	0.097	7nd2A.pdb.gz
18	PDB:7oseB	0.192	0.180	5.174E-1	377	0.152	0.138	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
19	PDB:6osaR	0.142	0.150	6.365E-1	321	0.109	0.115	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
20	PDB:4xesA	0.144	0.117	6.634E-1	471	0.123	0.089	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A3V2	0.0	605	341	0.856	0.856	S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus OX=10090 GN=Slc25a43 PE=2 SV=1
2	Q6I583	1.24e-44	158	355	0.279	0.268	Q6I583_ORYSJ Os05g0585900 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0585900 PE=1 SV=1
3	P16260	7.95e-40	145	332	0.270	0.277	GDC_HUMAN Solute carrier family 25 member 16 OS=Homo sapiens OX=9606 GN=SLC25A16 PE=1 SV=3
4	F4JHS4	9.73e-40	145	366	0.287	0.268	F4JHS4_ARATH Adenine nucleotide transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ADNT1 PE=1 SV=1
5	Q8C0K5	4.93e-39	142	332	0.267	0.274	GDC_MOUSE Solute carrier family 25 member 16 OS=Mus musculus OX=10090 GN=Slc25a16 PE=1 SV=1
6	Q9M058	5.04e-39	142	332	0.311	0.319	Q9M058_ARATH Ca-dependent solute carrier-like protein OS=Arabidopsis thaliana OX=3702 GN=F1I16_50 PE=1 SV=1
7	Q9SUV1	1.35e-35	135	392	0.264	0.230	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
8	A2CEQ0	2.59e-34	133	469	0.246	0.179	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
9	Q12251	6.00e-34	129	326	0.276	0.288	YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPR011C PE=1 SV=1
10	Q6NUK1	3.89e-33	130	477	0.238	0.170	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
11	Q0P483	7.30e-33	126	321	0.235	0.249	S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio OX=7955 GN=slc25a42 PE=2 SV=1
12	B4F8I5	1.02e-32	126	335	0.249	0.254	COAC2_MAIZE Mitochondrial carrier protein CoAc2 OS=Zea mays OX=4577 GN=COAC2 PE=2 SV=1
13	Q8BMD8	5.64e-32	126	475	0.252	0.181	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
14	O65023	9.89e-32	124	381	0.246	0.220	EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EAAC PE=2 SV=2
15	A2ASZ8	2.08e-31	125	469	0.243	0.177	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
16	K7VYZ9	2.09e-31	122	340	0.240	0.241	COAC1_MAIZE Mitochondrial carrier protein CoAc1 OS=Zea mays OX=4577 GN=COAC1 PE=2 SV=1
17	Q9M024	3.67e-31	123	415	0.243	0.200	TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TAAC PE=1 SV=1
18	P29518	8.16e-31	123	436	0.252	0.197	BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays OX=4577 GN=BT1 PE=1 SV=1
19	O94502	2.70e-30	121	426	0.243	0.195	YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12D12.05c PE=3 SV=2
20	Q8BVN7	5.17e-30	118	312	0.252	0.276	S2541_MOUSE Calcium-independent mitochondrial carrier protein SCaMC-3L OS=Mus musculus OX=10090 GN=Slc25a41 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19153 DUF5835	4.7e+02	12.2	Family of unknown function (DUF5835)
2	PF00153 Mito_carr	7.1e-58	203.9	Mitochondrial carrier protein
3	PF18405 SLC25_like	2.6e+02	12.0	Mitochondrial SLC25 homolog

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217909

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341524	0.804	Septin-6
2	9606.ENSP00000441786	0.694	UPF0428 protein CXorf56
3	9606.ENSP00000360497	0.687	RING finger protein 113A
4	9606.ENSP00000468980	0.664	Solute carrier family 25 member 53
5	9606.ENSP00000276202	0.632	Dedicator of cytokinesis protein 11
6	9606.ENSP00000334003	0.581	Protein inturned
7	9606.ENSP00000396452	0.556	Pseudouridine-5'-phosphatase
8	9606.ENSP00000296468	0.555	Major facilitator superfamily domain-containing protein 8
9	9606.ENSP00000361544	0.510	Nucleoporin-62 C-terminal-like protein
10	9606.ENSP00000360613	0.502	Ubiquitin-conjugating enzyme E2 A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	0.996	organic anion transmembrane transporter activity
GO:1901702	0.952	salt transmembrane transporter activity
GO:0005488	0.873	binding
GO:0015215	0.838	nucleotide transmembrane transporter activity
GO:0005515	0.732	protein binding
GO:0015216	0.485	purine nucleotide transmembrane transporter activity
GO:0005342	0.374	organic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0051179	0.925	localization
GO:0006810	0.907	transport
GO:0071702	0.752	organic substance transport
GO:0071705	0.545	nitrogen compound transport
GO:0055085	0.474	transmembrane transport
GO:0008152	0.442	metabolic process
GO:0071704	0.387	organic substance metabolic process
GO:0050789	0.327	regulation of biological process
GO:0050794	0.324	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0016020	0.475	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]