StarFunc result for job id Q8WUW1

User Input

>input (75 residues)
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR
IEYIEARVTKGETLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q8WUW1	1.000	1.000	2.993E-10	75	1.000	1.000	Q8WUW1.pdb.gz	BRK1_HUMAN Protein BRICK1 OS=Homo sapiens OX=9606 GN=BRK1 PE=1 SV=1
	2	AFDB:A0A1D8PH18	0.424	0.249	5.799	130	0.200	0.115	A0A1D8PH18.pdb.gz	A0A1D8PH18_CANAL Ino4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=INO4 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WUW1	4.85e-51	155	75	1.000	1.000	BRK1_HUMAN Protein BRICK1 OS=Homo sapiens OX=9606 GN=BRK1 PE=1 SV=1
2	Q91VR8	1.46e-50	154	75	0.987	0.987	BRK1_MOUSE Protein BRICK1 OS=Mus musculus OX=10090 GN=Brk1 PE=1 SV=1
3	Q8MLQ0	4.21e-37	120	76	0.747	0.737	Q8MLQ0_DROME FI14118p OS=Drosophila melanogaster OX=7227 GN=HSPC300 PE=1 SV=1
4	Q54X65	3.70e-16	67.4	68	0.373	0.412	BRK1_DICDI Protein BRICK1 OS=Dictyostelium discoideum OX=44689 GN=brk1 PE=1 SV=1
5	Q8RW98	4.63e-14	62.8	84	0.400	0.357	BRK1_MAIZE Protein BRICK1 OS=Zea mays OX=4577 GN=BRK1 PE=2 SV=1
6	Q94JY4	8.66e-13	59.3	85	0.333	0.294	BRK1_ARATH Protein BRICK 1 OS=Arabidopsis thaliana OX=3702 GN=BRK1 PE=1 SV=1
7	P13620	0.041	33.1	161	0.293	0.137	ATP5H_BOVIN ATP synthase subunit d, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PD PE=1 SV=2
8	Q9DCX2	0.092	32.0	161	0.240	0.112	ATP5H_MOUSE ATP synthase subunit d, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pd PE=1 SV=3
9	P31399	0.094	32.0	161	0.253	0.118	ATP5H_RAT ATP synthase subunit d, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pd PE=1 SV=3
10	H2KY91	0.13	31.6	420	0.267	0.048	DAC1_CAEEL Dachshund homolog dac-1 OS=Caenorhabditis elegans OX=6239 GN=dac-1 PE=2 SV=1
11	O75947	0.31	30.4	161	0.280	0.130	ATP5H_HUMAN ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3
12	E7EY31	1.6	28.9	1022	0.213	0.016	E7EY31_DANRE Coiled-coil domain-containing 57 OS=Danio rerio OX=7955 GN=ccdc57 PE=4 SV=1
13	Q54N50	2.3	28.1	430	0.200	0.035	DCTN2_DICDI Dynactin subunit 2 OS=Dictyostelium discoideum OX=44689 GN=dynB PE=3 SV=1
14	Q96A58	3.2	27.7	199	0.133	0.050	RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens OX=9606 GN=RERG PE=1 SV=1
15	D3Z2X2	4.5	27.7	4749	0.187	0.003	DNHD1_MOUSE Dynein heavy chain domain-containing protein 1 OS=Mus musculus OX=10090 GN=Dnhd1 PE=1 SV=3
16	Q92637	4.5	27.3	280	0.107	0.029	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
17	G5EEU6	5.4	27.3	1542	0.267	0.013	G5EEU6_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=3 SV=1
18	P12314	5.4	27.3	374	0.107	0.021	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
19	Q6DEG0	7.6	26.9	573	0.213	0.028	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10152 CCDC53	1.7	20.6	Subunit CCDC53 of WASH complex
2	PF04740 LXG	2.4e+02	12.9	LXG domain of WXG superfamily
3	PF10393 Matrilin_ccoil	2.5e+02	12.9	Trimeric coiled-coil oligomerisation domain of matrilin
4	PF09278 MerR-DNA-bind	2e+02	13.9	MerR, DNA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 144197.XP_008284280.1

Rank	PPI partner	STRING score	Description
1	144197.XP_008276348.1	0.999	Belongs to the CYFIP family.
2	144197.XP_008296470.1	0.999	wiskott-Aldrich syndrome protein family member 1 isoform X1
3	144197.XP_008301543.1	0.999	Nck-associated protein 1 isoform X1
4	144197.XP_008279482.1	0.997	Belongs to the CYFIP family.
5	144197.XP_008280321.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns
6	144197.XP_008288694.1	0.994	wiskott-Aldrich syndrome protein family member 2
7	144197.XP_008275892.1	0.986	Abl interactor 1-like isoform X1
8	144197.XP_008293510.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
9	144197.XP_008299859.1	0.985	wiskott-Aldrich syndrome protein family member 3-like
10	144197.XP_008283443.1	0.984	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks
11	144197.XP_008283879.1	0.984	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
12	144197.XP_008293625.1	0.984	Abl interactor 2-like isoform X1
13	144197.XP_008296393.1	0.984	Abl interactor 2-like
14	144197.XP_008304196.1	0.976	wiskott-Aldrich syndrome protein family member 3-like
15	144197.XP_008304587.1	0.976	wiskott-Aldrich syndrome protein family member 3-like
16	144197.XP_008303127.1	0.972	Actin-related protein 2/3 complex subunit 2
17	144197.XP_008287819.1	0.967	wiskott-Aldrich syndrome protein family member 3-like
18	144197.XP_008274470.1	0.963	wiskott-Aldrich syndrome protein family member 3-like
19	144197.XP_008288445.1	0.962	Actin-related protein 2/3 complex subunit 1A-like
20	144197.XP_008296260.1	0.962	Actin-related protein 2/3 complex subunit 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019899	0.989	enzyme binding
GO:0044877	0.987	protein-containing complex binding
GO:0031267	0.972	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0048522	0.975	positive regulation of cellular process
GO:0051128	0.941	regulation of cellular component organization
GO:0044087	0.898	regulation of cellular component biogenesis
GO:0051130	0.894	positive regulation of cellular component organization
GO:0044089	0.832	positive regulation of cellular component biogenesis
GO:0071840	0.813	cellular component organization or biogenesis
GO:0050896	0.806	response to stimulus
GO:0016043	0.791	cellular component organization
GO:0051716	0.762	cellular response to stimulus
GO:0120035	0.753	regulation of plasma membrane bounded cell projection organization
GO:0120032	0.700	regulation of plasma membrane bounded cell projection assembly
GO:0007154	0.686	cell communication
GO:0007165	0.665	signal transduction
GO:0051493	0.664	regulation of cytoskeleton organization
GO:0032956	0.615	regulation of actin cytoskeleton organization
GO:0110053	0.611	regulation of actin filament organization
GO:0006996	0.561	organelle organization
GO:0010638	0.543	positive regulation of organelle organization
GO:1902743	0.542	regulation of lamellipodium organization
GO:0031346	0.522	positive regulation of cell projection organization
GO:0120034	0.507	positive regulation of plasma membrane bounded cell projection assembly
GO:0010591	0.487	regulation of lamellipodium assembly
GO:0032502	0.447	developmental process
GO:0048856	0.432	anatomical structure development
GO:0010592	0.420	positive regulation of lamellipodium assembly
GO:0032501	0.413	multicellular organismal process
GO:0035556	0.400	intracellular signal transduction
GO:0030036	0.380	actin cytoskeleton organization
GO:1902905	0.349	positive regulation of supramolecular fiber organization
GO:0051495	0.347	positive regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.995	cytosol
GO:0043227	0.994	membrane-bounded organelle
GO:0005576	0.985	extracellular region
GO:0070062	0.975	extracellular exosome
GO:0120025	0.912	plasma membrane bounded cell projection
GO:0031252	0.865	cell leading edge
GO:0016020	0.809	membrane
GO:0043229	0.799	intracellular organelle
GO:0043231	0.767	intracellular membrane-bounded organelle
GO:0031209	0.717	SCAR complex
GO:0043232	0.459	intracellular non-membrane-bounded organelle
GO:0030027	0.335	lamellipodium
GO:0012505	0.328	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]