StarFunc result for job id Q8WUZ0

User Input

>input (217 residues)
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERR
RAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQ
PSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEA
YPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08664	0.333	0.333	2.889E-28	217	0.931	0.931	O08664.pdb.gz	BCL7C_MOUSE B-cell CLL/lymphoma 7 protein family member C OS=Mus musculus OX=10090 GN=Bcl7c PE=1 SV=1
2	AFDB:Q921K9	0.319	0.341	2.765E-12	202	0.461	0.495	Q921K9.pdb.gz	BCL7B_MOUSE B-cell CLL/lymphoma 7 protein family member B OS=Mus musculus OX=10090 GN=Bcl7b PE=1 SV=1
3	AFDB:Q4VC05	0.258	0.266	8.515E-9	210	0.346	0.357	Q4VC05.pdb.gz	BCL7A_HUMAN B-cell CLL/lymphoma 7 protein family member A OS=Homo sapiens OX=9606 GN=BCL7A PE=1 SV=1
4	AFDB:P87060	0.105	0.040	6.781E-1	775	0.106	0.030	P87060.pdb.gz	POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop1 PE=1 SV=1
5	AFDB:Q8N6W0	0.078	0.048	1.545	485	0.166	0.074	Q8N6W0.pdb.gz	CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens OX=9606 GN=CELF5 PE=1 SV=1
6	AFDB:Q13247	0.095	0.066	1.773	344	0.138	0.087	Q13247.pdb.gz	SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2
7	PDB:3zqqC	0.144	0.203	2.101	134	0.060	0.097	3zqqC.pdb.gz
8	PDB:6hivCn	0.085	0.165	2.410	110	0.074	0.145	6hivCn.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
9	AFDB:Q384A0	0.120	0.045	2.499	763	0.184	0.052	Q384A0.pdb.gz	Q384A0_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1050 PE=4 SV=1
10	AFDB:Q86UU5	0.094	0.038	2.677	652	0.221	0.074	Q86UU5.pdb.gz	GGN_HUMAN Gametogenetin OS=Homo sapiens OX=9606 GN=GGN PE=1 SV=2
11	PDB:2zdiC	0.103	0.148	3.397	148	0.037	0.054	2zdiC.pdb.gz
12	AFDB:Q68DI1	0.110	0.062	3.773	518	0.111	0.046	Q68DI1.pdb.gz	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
13	AFDB:A2WVZ6	0.095	0.089	4.041	235	0.138	0.128	A2WVZ6.pdb.gz	A2WVZ6_ORYSI AP2/ERF family protein OS=Oryza sativa subsp. indica OX=39946 GN=AP37 PE=2 SV=1
14	PDB:6faiG	0.075	0.072	4.173	232	0.046	0.043	6faiG.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
15	PDB:7d4iSH	0.096	0.108	4.173	182	0.065	0.077	7d4iSH.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	PDB:2efcB	0.080	0.094	5.128	165	0.014	0.018	2efcB.pdb.gz	GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
17	PDB:2zdiB	0.103	0.189	5.492	106	0.037	0.075	2zdiB.pdb.gz
18	PDB:6mzcK	0.132	0.138	5.492	202	0.037	0.040	6mzcK.pdb.gz
19	PDB:7mscg	0.113	0.104	6.748	155	0.060	0.084	7mscg.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
20	PDB:7z1mO	0.065	0.032	7.228	570	0.032	0.012	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WUZ0	1.83e-152	423	217	1.000	1.000	BCL7C_HUMAN B-cell CLL/lymphoma 7 protein family member C OS=Homo sapiens OX=9606 GN=BCL7C PE=1 SV=3
2	O08664	3.83e-130	367	217	0.931	0.931	BCL7C_MOUSE B-cell CLL/lymphoma 7 protein family member C OS=Mus musculus OX=10090 GN=Bcl7c PE=1 SV=1
3	Q9BQE9	8.68e-51	165	202	0.479	0.515	BCL7B_HUMAN B-cell CLL/lymphoma 7 protein family member B OS=Homo sapiens OX=9606 GN=BCL7B PE=1 SV=1
4	Q921K9	9.05e-49	160	202	0.479	0.515	BCL7B_MOUSE B-cell CLL/lymphoma 7 protein family member B OS=Mus musculus OX=10090 GN=Bcl7b PE=1 SV=1
5	Q9CXE2	1.66e-30	113	210	0.309	0.319	BCL7A_MOUSE B-cell CLL/lymphoma 7 protein family member A OS=Mus musculus OX=10090 GN=Bcl7a PE=2 SV=1
6	Q4VC05	2.97e-30	112	210	0.295	0.305	BCL7A_HUMAN B-cell CLL/lymphoma 7 protein family member A OS=Homo sapiens OX=9606 GN=BCL7A PE=1 SV=1
7	Q4VA53	0.016	38.5	1446	0.157	0.024	PDS5B_MOUSE Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus OX=10090 GN=Pds5b PE=1 SV=1
8	X1WD79	2.5	31.6	1138	0.115	0.022	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
9	Q9P7L2	5.1	30.4	425	0.097	0.049	UBX4_SCHPO UBX domain-containing protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubx4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04714 BCL_N	1.1e-23	94.3	BCL7, N-terminal conserver region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019460

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007986	0.901	SS18, nBAF chromatin remodeling complex subunit
2	61853.ENSNLEP00000006764	0.869	D4, zinc and double PHD fingers family 2
3	61853.ENSNLEP00000005008	0.848	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
4	61853.ENSNLEP00000001015	0.838	Bromodomain containing 7
5	61853.ENSNLEP00000005368	0.835	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
6	61853.ENSNLEP00000021627	0.834	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
7	61853.ENSNLEP00000021282	0.830	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
8	61853.ENSNLEP00000002500	0.825	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
9	61853.ENSNLEP00000007734	0.825	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
10	61853.ENSNLEP00000019002	0.813	AT rich interactive domain 1B (SWI1-like)
11	61853.ENSNLEP00000000633	0.806	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
12	61853.ENSNLEP00000015131	0.806	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
13	61853.ENSNLEP00000011400	0.801	AT rich interactive domain 1A (SWI-like)
14	61853.ENSNLEP00000021768	0.793	AT rich interactive domain 2 (ARID, RFX-like)
15	61853.ENSNLEP00000010477	0.747	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
16	61853.ENSNLEP00000023571	0.747	Uncharacterized protein
17	61853.ENSNLEP00000015860	0.697	Ras protein-specific guanine nucleotide-releasing factor 2
18	61853.ENSNLEP00000002949	0.695	D4, zinc and double PHD fingers, family 3
19	61853.ENSNLEP00000015585	0.692	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
20	61853.ENSNLEP00000014232	0.690	Cytochrome c oxidase assembly homolog 19 (S. cerevisiae)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.966	regulation of cellular process
GO:0032502	0.894	developmental process
GO:0032501	0.866	multicellular organismal process
GO:0019222	0.762	regulation of metabolic process
GO:0048856	0.724	anatomical structure development
GO:0007275	0.677	multicellular organism development
GO:0048731	0.628	system development
GO:0009987	0.492	cellular process
GO:0060255	0.492	regulation of macromolecule metabolic process
GO:0031323	0.470	regulation of cellular metabolic process
GO:0080090	0.449	regulation of primary metabolic process
GO:0051171	0.445	regulation of nitrogen compound metabolic process
GO:0048519	0.334	negative regulation of biological process
GO:0048523	0.303	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016514	1.000	SWI/SNF complex
GO:0070013	0.378	intracellular organelle lumen
GO:0031981	0.374	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]