StarFunc result for job id Q8WV41

User Input

>input (574 residues)
MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIVR
SGISTNHADYSSSPAGSPGAQVSLYNSPSVASPARSGGGSGFLSNQGSFEEDDDDDWDDW
DDGCTVVEEPRAGGLGTNGHPPLNLSYPGAYPSQHMAFRPKPPLERQDSLASAKRGSVVG
RNLNRFSCFVRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQ
TKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEE
DFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLL
TFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSA
FQAISHSFQMDPPFCSEALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLS
NFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRREL
DFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WV41	1.000	1.000	4.567E-86	574	1.000	1.000	Q8WV41.pdb.gz	SNX33_HUMAN Sorting nexin-33 OS=Homo sapiens OX=9606 GN=SNX33 PE=1 SV=1
2	AFDB:Q91ZR2	0.669	0.627	3.321E-49	614	0.517	0.484	Q91ZR2.pdb.gz	SNX18_MOUSE Sorting nexin-18 OS=Mus musculus OX=10090 GN=Snx18 PE=1 SV=1
3	AFDB:Q96RF0	0.544	0.499	3.732E-43	628	0.467	0.427	Q96RF0.pdb.gz	SNX18_HUMAN Sorting nexin-18 OS=Homo sapiens OX=9606 GN=SNX18 PE=1 SV=2
4	AFDB:Q8I4E2	0.710	0.720	2.274E-42	566	0.350	0.355	Q8I4E2.pdb.gz	LST4_CAEEL Sorting nexin lst-4 OS=Caenorhabditis elegans OX=6239 GN=lst-4 PE=1 SV=1
5	AFDB:Q9Y5X1	0.647	0.625	4.547E-41	595	0.376	0.363	Q9Y5X1.pdb.gz	SNX9_HUMAN Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1
6	AFDB:Q9NCC3	0.662	0.672	7.518E-40	565	0.326	0.331	Q9NCC3.pdb.gz	Q9NCC3_DROME Sorting nexin OS=Drosophila melanogaster OX=7227 GN=SH3PX1 PE=1 SV=1
7	AFDB:M0R9L3	0.632	0.613	5.282E-39	593	0.375	0.363	M0R9L3.pdb.gz	M0R9L3_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=3
8	AFDB:Q9FG38	0.456	0.630	1.267E-13	402	0.141	0.201	Q9FG38.pdb.gz	SNX1_ARATH Sorting nexin 1 OS=Arabidopsis thaliana OX=3702 GN=SNX1 PE=1 SV=1
9	AFDB:O14120	0.396	0.352	8.091E-13	664	0.131	0.113	O14120.pdb.gz	MVP1_SCHPO Sorting nexin mvp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mvp1 PE=3 SV=3
10	PDB:6q0xA	0.420	0.602	4.013E-7	373	0.094	0.145	6q0xA.pdb.gz
11	PDB:7d6dA	0.400	0.571	1.638E-5	380	0.136	0.205	7d6dA.pdb.gz
12	AFDB:Q64355	0.105	0.108	3.711E-5	560	0.169	0.173	Q64355.pdb.gz	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
13	PDB:3ehqA	0.096	0.292	5.525E-4	182	0.030	0.093	3ehqA.pdb.gz
14	PDB:1k9aB	0.095	0.122	8.083E-4	441	0.026	0.034	1k9aB.pdb.gz
15	PDB:3qwyA	0.095	0.313	8.477E-4	170	0.033	0.112	3qwyA.pdb.gz
16	PDB:2eyzA	0.102	0.187	2.301E-3	304	0.037	0.069	2eyzA.pdb.gz
17	PDB:1griA	0.103	0.272	2.918E-3	211	0.026	0.071	1griA.pdb.gz
18	PDB:2dybA	0.096	0.183	4.695E-3	298	0.031	0.060	2dybA.pdb.gz
19	PDB:2mxcA	0.161	0.469	6.245E-3	172	0.068	0.227	2mxcA.pdb.gz
20	PDB:4pzgA	0.185	0.641	6.245E-3	152	0.054	0.204	4pzgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WV41	0.0	1202	574	1.000	1.000	SNX33_HUMAN Sorting nexin-33 OS=Homo sapiens OX=9606 GN=SNX33 PE=1 SV=1
2	Q96RF0	3.74e-163	481	628	0.458	0.419	SNX18_HUMAN Sorting nexin-18 OS=Homo sapiens OX=9606 GN=SNX18 PE=1 SV=2
3	Q91ZR2	1.36e-158	468	614	0.383	0.358	SNX18_MOUSE Sorting nexin-18 OS=Mus musculus OX=10090 GN=Snx18 PE=1 SV=1
4	B0BNM3	6.44e-119	366	595	0.394	0.380	B0BNM3_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1
5	Q91VH2	6.69e-118	363	595	0.385	0.371	SNX9_MOUSE Sorting nexin-9 OS=Mus musculus OX=10090 GN=Snx9 PE=1 SV=1
6	A0A8I6AC77	1.80e-117	362	594	0.390	0.377	A0A8I6AC77_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1
7	M0R9L3	1.32e-116	360	613	0.392	0.367	M0R9L3_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=3
8	A0A8I6A3C7	1.46e-116	361	628	0.390	0.357	A0A8I6A3C7_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1
9	A0A8I6GJY7	2.07e-116	361	643	0.389	0.347	A0A8I6GJY7_RAT Sorting nexin 9 OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1
10	Q9Y5X1	5.78e-114	353	595	0.376	0.363	SNX9_HUMAN Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1
11	A0A8I6AME1	8.27e-112	347	592	0.378	0.367	A0A8I6AME1_RAT Sorting nexin OS=Rattus norvegicus OX=10116 GN=Snx9 PE=1 SV=1
12	Q8I4E2	3.40e-105	330	566	0.347	0.352	LST4_CAEEL Sorting nexin lst-4 OS=Caenorhabditis elegans OX=6239 GN=lst-4 PE=1 SV=1
13	Q9NCC3	4.29e-96	306	565	0.329	0.335	Q9NCC3_DROME Sorting nexin OS=Drosophila melanogaster OX=7227 GN=SH3PX1 PE=1 SV=1
14	Q9FG38	2.58e-13	74.3	402	0.084	0.119	SNX1_ARATH Sorting nexin 1 OS=Arabidopsis thaliana OX=3702 GN=SNX1 PE=1 SV=1
15	Q5VWJ9	1.04e-12	72.4	437	0.136	0.178	SNX30_HUMAN Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1
16	A0A0R4IIY5	3.22e-12	70.9	435	0.139	0.184	A0A0R4IIY5_DANRE Sorting nexin-7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
17	Q6GMJ0	6.14e-12	70.1	413	0.139	0.194	Q6GMJ0_DANRE Zgc:92458 OS=Danio rerio OX=7955 GN=zgc:92458 PE=2 SV=1
18	A0A0R4IBS8	8.97e-12	69.7	469	0.148	0.181	A0A0R4IBS8_DANRE Sorting nexin 7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
19	Q9C0U7	9.55e-10	63.5	576	0.063	0.062	VPS5_SCHPO Vacuolar protein sorting-associated protein vps5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps5 PE=1 SV=1
20	Q9Y5X2	6.95e-09	60.8	465	0.110	0.135	SNX8_HUMAN Sorting nexin-8 OS=Homo sapiens OX=9606 GN=SNX8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10456 BAR_3_WASP_bdg	1.9e-105	363.1	WASP-binding domain of Sorting nexin protein
2	PF12237 PCIF1_WW	47	15.0	Phosphorylated CTD interacting factor 1 WW domain
3	PF00787 PX	9.8e-16	69.6	PX domain
4	PF00018 SH3_1	8.8e-06	36.6	SH3 domain
5	PF07653 SH3_2	0.00012	33.2	Variant SH3 domain
6	PF14604 SH3_9	1.8e-08	45.5	Variant SH3 domain
7	PF09325 Vps5	28	15.8	Vps5 C terminal like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311427

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376024	0.941	Sorting nexin-9
2	9606.ENSP00000479101	0.846	Ectoderm-neural cortex protein 1
3	9606.ENSP00000317332	0.813	Sorting nexin-18
4	9606.ENSP00000349436	0.794	Disintegrin and metalloproteinase domain-containing protein 15
5	9606.ENSP00000481314	0.789	Sorting nexin-12
6	9606.ENSP00000251775	0.777	Sorting nexin-4
7	9606.ENSP00000356694	0.777	Tumor necrosis factor ligand superfamily member 6
8	9606.ENSP00000377059	0.769	Sorting nexin-11
9	9606.ENSP00000365891	0.754	Wiskott-Aldrich syndrome protein
10	9606.ENSP00000366998	0.736	Sorting nexin-5
11	9606.ENSP00000355217	0.722	Sorting nexin-6
12	9606.ENSP00000362014	0.706	Dynamin-1
13	9606.ENSP00000399259	0.698	FCH and double SH3 domains 1
14	9606.ENSP00000265970	0.679	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
15	9606.ENSP00000355046	0.679	NADH-ubiquinone oxidoreductase chain 2
16	9606.ENSP00000356155	0.679	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
17	9606.ENSP00000418593	0.666	Sorting nexin-21
18	9606.ENSP00000344125	0.648	Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
19	9606.ENSP00000299138	0.644	Vacuolar protein sorting-associated protein 35
20	9606.ENSP00000445381	0.634	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0035091	0.938	phosphatidylinositol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.966	regulation of metabolic process
GO:0051128	0.925	regulation of cellular component organization
GO:0048518	0.919	positive regulation of biological process
GO:0016192	0.910	vesicle-mediated transport
GO:0016043	0.898	cellular component organization
GO:0046907	0.895	intracellular transport
GO:0016197	0.884	endosomal transport
GO:0031323	0.871	regulation of cellular metabolic process
GO:0048522	0.862	positive regulation of cellular process
GO:0009894	0.860	regulation of catabolic process
GO:0032879	0.837	regulation of localization
GO:0009893	0.806	positive regulation of metabolic process
GO:0045184	0.802	establishment of protein localization
GO:0016050	0.789	vesicle organization
GO:0061024	0.774	membrane organization
GO:0015031	0.715	protein transport
GO:0006897	0.714	endocytosis
GO:0000910	0.702	cytokinesis
GO:0060255	0.701	regulation of macromolecule metabolic process
GO:0010324	0.693	membrane invagination
GO:0080090	0.680	regulation of primary metabolic process
GO:0051171	0.679	regulation of nitrogen compound metabolic process
GO:0010256	0.650	endomembrane system organization
GO:0048519	0.603	negative regulation of biological process
GO:0048523	0.561	negative regulation of cellular process
GO:0051246	0.559	regulation of protein metabolic process
GO:0031325	0.557	positive regulation of cellular metabolic process
GO:0032506	0.555	cytokinetic process
GO:0031329	0.490	regulation of cellular catabolic process
GO:0009896	0.478	positive regulation of catabolic process
GO:0042176	0.455	regulation of protein catabolic process
GO:0060341	0.433	regulation of cellular localization
GO:0051049	0.394	regulation of transport
GO:0099024	0.371	plasma membrane invagination
GO:0032880	0.369	regulation of protein localization
GO:0061640	0.360	cytoskeleton-dependent cytokinesis
GO:0010604	0.350	positive regulation of macromolecule metabolic process
GO:0000281	0.338	mitotic cytokinesis
GO:0060627	0.314	regulation of vesicle-mediated transport
GO:0050896	0.310	response to stimulus
GO:0031331	0.308	positive regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0031982	0.999	vesicle
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031410	0.992	cytoplasmic vesicle
GO:0005829	0.963	cytosol
GO:0012505	0.924	endomembrane system
GO:0071944	0.907	cell periphery
GO:0005886	0.904	plasma membrane
GO:0019898	0.834	extrinsic component of membrane
GO:0005768	0.436	endosome
GO:0012506	0.407	vesicle membrane
GO:0030659	0.386	cytoplasmic vesicle membrane
GO:0070062	0.356	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]