StarFunc result for job id Q8WV44

User Input

>input (630 residues)
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNM
DYVWEEEDEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEVEEEDLDPVTPLPPPPAPRRC
FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFCEV
DEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVT
ELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQL
SRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRK
MSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQG
FRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLP
QQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH
VHTFSAAFLGERVFPFFRVLSKGTRIKLCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5NCC3	0.675	0.675	3.757E-96	630	0.937	0.937	Q5NCC3.pdb.gz	TRI41_MOUSE E3 ubiquitin-protein ligase TRIM41 OS=Mus musculus OX=10090 GN=Trim41 PE=1 SV=1
2	AFDB:Q9C029	0.260	0.310	1.972E-41	511	0.313	0.386	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
3	AFDB:Q923T7	0.268	0.315	4.809E-41	510	0.311	0.384	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
4	AFDB:A0A024RCR1	0.269	0.343	1.831E-40	488	0.303	0.391	A0A024RCR1.pdb.gz
5	AFDB:A0A024RCP5	0.264	0.317	5.081E-38	518	0.305	0.371	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
6	AFDB:A0A1U9X8R9	0.280	0.328	3.990E-37	513	0.290	0.357	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
7	AFDB:Q96F44	0.257	0.340	3.990E-37	468	0.316	0.425	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
8	AFDB:Q495X7	0.257	0.339	7.786E-37	471	0.252	0.338	Q495X7.pdb.gz	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
9	AFDB:Q5NCC9	0.262	0.336	9.729E-37	485	0.273	0.355	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
10	AFDB:Q99PQ2	0.258	0.342	1.359E-36	467	0.306	0.413	Q99PQ2.pdb.gz	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
11	PDB:7y4sA	0.263	0.456	4.614E-18	343	0.149	0.274	7y4sA.pdb.gz
12	PDB:4b3nA	0.219	0.246	2.791E-12	557	0.092	0.104	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.209	0.332	1.456E-7	362	0.086	0.149	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:6swy1	0.194	0.223	3.682E-6	542	0.063	0.074	6swy1.pdb.gz
15	PDB:7ccbA	0.179	0.614	7.596E-6	164	0.041	0.159	7ccbA.pdb.gz
16	PDB:7nscA	0.213	0.449	1.061E-5	276	0.035	0.080	7nscA.pdb.gz
17	PDB:7z36B	0.241	0.324	1.186E-5	446	0.068	0.096	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
18	PDB:7nsba	0.183	0.201	2.735E-5	568	0.048	0.053	7nsba.pdb.gz
19	PDB:7tzcA	0.153	0.028	5.966E-5	4404	0.057	0.008	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
20	PDB:7ua3A	0.139	0.024	3.354E-4	4443	0.044	0.006	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5NCC3	0.0	996	630	0.924	0.924	TRI41_MOUSE E3 ubiquitin-protein ligase TRIM41 OS=Mus musculus OX=10090 GN=Trim41 PE=1 SV=1
2	Q8WV44	0.0	1289	630	1.000	1.000	TRI41_HUMAN E3 ubiquitin-protein ligase TRIM41 OS=Homo sapiens OX=9606 GN=TRIM41 PE=1 SV=3
3	Q96A61	4.88e-94	293	297	0.276	0.586	TRI52_HUMAN E3 ubiquitin-protein ligase TRIM52 OS=Homo sapiens OX=9606 GN=TRIM52 PE=1 SV=1
4	A0A024RCP5	2.47e-84	275	518	0.267	0.324	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
5	Q9HCM9	2.47e-84	275	518	0.267	0.324	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
6	A0A1U9X8R9	1.67e-77	257	513	0.259	0.318	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
7	P14373	1.67e-77	257	513	0.259	0.318	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
8	Q62158	1.90e-77	257	513	0.260	0.320	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
9	Q9C029	2.38e-76	254	511	0.276	0.341	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
10	Q923T7	2.90e-75	251	510	0.270	0.333	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
11	Q96F44	7.82e-75	249	468	0.267	0.359	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
12	Q99PQ2	7.72e-71	238	467	0.257	0.347	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
13	Q495X7	1.18e-66	227	471	0.216	0.289	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
14	Q6AZZ1	1.88e-66	227	485	0.243	0.315	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
15	A0A096LP39	5.64e-64	221	503	0.197	0.247	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
16	P19474	3.88e-63	218	475	0.233	0.309	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
17	Q5NCC9	3.68e-61	213	485	0.237	0.307	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
18	Q3U7K7	2.94e-60	210	462	0.229	0.312	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
19	Q62191	4.46e-60	209	470	0.229	0.306	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
20	Q9WUH5	2.21e-59	208	489	0.243	0.313	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01442 Apolipoprotein	32	15.8	Apolipoprotein A1/A4/E domain
2	PF07889 DUF1664	9.3e+02	11.3	Protein of unknown function (DUF1664)
3	PF12307 DUF3631	14	17.5	Protein of unknown function (DUF3631)
4	PF13765 PRY	9.7e-17	71.6	SPRY-associated domain
5	PF00622 SPRY	4.6e-09	47.8	SPRY domain
6	PF00643 zf-B_box	3.4e-06	38.4	B-box zinc finger
7	PF00097 zf-C3HC4	3.7e-05	34.8	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	0.0012	29.9	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.41	21.8	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	1.5e-08	45.9	zinc finger of C3HC4-type, RING
11	PF13639 zf-RING_2	0.24	23.1	Ring finger domain
12	PF14634 zf-RING_5	14	17.1	zinc-RING finger domain
13	PF14835 zf-RING_6	54	15.1	zf-RING of BARD1-type protein
14	PF13445 zf-RING_UBOX	3.3e-06	38.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381773	0.881	DNA topoisomerase 3-beta-1
2	9606.ENSP00000256649	0.816	Tripartite motif-containing protein 45
3	9606.ENSP00000472808	0.681	Zinc finger protein 473
4	9606.ENSP00000295756	0.660	T-cell receptor-associated transmembrane adapter 1
5	9606.ENSP00000349085	0.660	Melanoma-associated antigen 1
6	9606.ENSP00000263182	0.614	Gamma-butyrobetaine dioxygenase
7	9606.ENSP00000408695	0.571	Protein kinase C alpha type
8	9606.ENSP00000305355	0.557	Protein kinase C beta type
9	9606.ENSP00000445508	0.525	CCR4-NOT transcription complex subunit 4
10	9606.ENSP00000478388	0.522	Protein NATD1
11	9606.ENSP00000384876	0.510	Tripartite motif-containing protein 66
12	9606.ENSP00000310726	0.507	Mitochondrial ribosomal protein L57
13	9606.ENSP00000164133	0.504	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
14	9606.ENSP00000408292	0.502	E3 ubiquitin-protein ligase TRIM32

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.872	catalytic activity
GO:0016740	0.794	transferase activity
GO:0140096	0.752	catalytic activity, acting on a protein
GO:0019787	0.586	ubiquitin-like protein transferase activity
GO:0004842	0.570	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006952	0.995	defense response
GO:0051707	0.993	response to other organism
GO:0050794	0.991	regulation of cellular process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0009987	0.981	cellular process
GO:0048518	0.964	positive regulation of biological process
GO:0019538	0.959	protein metabolic process
GO:0098542	0.952	defense response to other organism
GO:0032446	0.946	protein modification by small protein conjugation
GO:0048583	0.945	regulation of response to stimulus
GO:0048522	0.945	positive regulation of cellular process
GO:0032101	0.943	regulation of response to external stimulus
GO:0009966	0.938	regulation of signal transduction
GO:0002831	0.922	regulation of response to biotic stimulus
GO:0031347	0.920	regulation of defense response
GO:0009615	0.920	response to virus
GO:0016567	0.920	protein ubiquitination
GO:0048584	0.916	positive regulation of response to stimulus
GO:0023056	0.910	positive regulation of signaling
GO:0010647	0.910	positive regulation of cell communication
GO:0050776	0.908	regulation of immune response
GO:0009967	0.877	positive regulation of signal transduction
GO:0051607	0.872	defense response to virus
GO:0032103	0.863	positive regulation of response to external stimulus
GO:0002684	0.814	positive regulation of immune system process
GO:0045089	0.789	positive regulation of innate immune response
GO:0001961	0.765	positive regulation of cytokine-mediated signaling pathway
GO:0051716	0.753	cellular response to stimulus
GO:0019222	0.596	regulation of metabolic process
GO:0060255	0.562	regulation of macromolecule metabolic process
GO:0060338	0.549	regulation of type I interferon-mediated signaling pathway
GO:0033993	0.530	response to lipid
GO:1901700	0.470	response to oxygen-containing compound
GO:0031323	0.466	regulation of cellular metabolic process
GO:0048519	0.399	negative regulation of biological process
GO:0010468	0.388	regulation of gene expression
GO:0080090	0.372	regulation of primary metabolic process
GO:0051171	0.371	regulation of nitrogen compound metabolic process
GO:0044237	0.370	cellular metabolic process
GO:0048523	0.311	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005737	0.965	cytoplasm
GO:0016604	0.712	nuclear body
GO:0005730	0.602	nucleolus
GO:0005829	0.347	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.794	Transferases.

[back to server]