StarFunc result for job id Q8WV60

User Input

>input (388 residues)
MVRDSMAAAFRPSNRVLLQALQILVYPGVGGSGSVSCRCPLGAKRYLLTDNVVKLKEFQQ
KKVAVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKNVIYRYHA
ENKNFTLGEYKFGPLFVRLCYELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGK
YKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRA
SCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGN
LSKFVKRHVFSEEVLAKVREKVKDVPALVAKFDEIYGTLHITGQVTTDSLDAVLCHTPRD
RKSHTLLLNKRMVSRRTFQPLSQSLLAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WV60	1.000	1.000	8.598E-50	388	1.000	1.000	Q8WV60.pdb.gz	PTCD2_HUMAN Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD2 PE=1 SV=3
2	AFDB:Q8R3K3	0.884	0.900	5.439E-39	381	0.714	0.727	Q8R3K3.pdb.gz	PTCD2_MOUSE Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd2 PE=1 SV=1
3	AFDB:A0A024RAJ1	0.377	0.355	3.358E-8	414	0.152	0.143	A0A024RAJ1.pdb.gz
4	AFDB:Q8BK72	0.376	0.354	6.022E-8	415	0.149	0.140	Q8BK72.pdb.gz	RT27_MOUSE Small ribosomal subunit protein mS27 OS=Mus musculus OX=10090 GN=Mrps27 PE=1 SV=2
5	AFDB:Q32PI8	0.373	0.352	6.546E-8	415	0.152	0.142	Q32PI8.pdb.gz	RT27_BOVIN Small ribosomal subunit protein mS27 OS=Bos taurus OX=9913 GN=MRPS27 PE=1 SV=1
6	PDB:7pntV	0.346	0.366	1.369E-7	365	0.126	0.134	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
7	AFDB:Q1JPP0	0.500	0.498	2.090E-6	390	0.134	0.133	Q1JPP0.pdb.gz	Q1JPP0_ARATH Adenylyl cyclase OS=Arabidopsis thaliana OX=3702 GN=DL3860C PE=1 SV=1
8	AFDB:Q9SIC9	0.436	0.215	1.367E-5	918	0.144	0.061	Q9SIC9.pdb.gz	PP178_ARATH Pentatricopeptide repeat-containing protein GUN1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GUN1 PE=2 SV=1
9	AFDB:Q7Y211	0.433	0.206	2.163E-5	890	0.142	0.062	Q7Y211.pdb.gz	PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H81 PE=2 SV=2
10	AFDB:Q9LG23	0.400	0.392	2.163E-5	398	0.134	0.131	Q9LG23.pdb.gz	PPR82_ARATH Small ribosomal subunit protein mS78 (rPPR3a) OS=Arabidopsis thaliana OX=3702 GN=At1g55890 PE=1 SV=1
11	AFDB:A3KPF8	0.307	0.227	3.149E-5	576	0.134	0.090	A3KPF8.pdb.gz	PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g79080 PE=2 SV=1
12	PDB:4m57A	0.312	0.193	2.503E-4	702	0.180	0.100	4m57A.pdb.gz
13	PDB:6neqe	0.335	0.360	2.721E-4	358	0.124	0.134	6neqe.pdb.gz	Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
14	PDB:7l08AV	0.319	0.336	3.961E-4	367	0.121	0.128	7l08AV.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
15	PDB:6yxxE6	0.395	0.359	2.700E-3	434	0.134	0.120	6yxxE6.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:7qe7Y	0.322	0.259	9.057E-3	502	0.116	0.090	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:6hivDH	0.279	0.204	1.116E-2	564	0.124	0.085	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:7po24	0.397	0.279	1.163E-2	592	0.111	0.073	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
19	PDB:3txmA	0.295	0.317	1.558E-2	353	0.108	0.119	3txmA.pdb.gz
20	PDB:7onuE	0.270	0.228	1.558E-2	467	0.103	0.086	7onuE.pdb.gz	Structural basis of RNA processing by human mitochondrial RNase P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R3K3	0.0	588	381	0.724	0.738	PTCD2_MOUSE Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd2 PE=1 SV=1
2	Q8WV60	0.0	798	388	1.000	1.000	PTCD2_HUMAN Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD2 PE=1 SV=3
3	B3KPU6	2.46e-173	484	236	0.608	1.000	B3KPU6_HUMAN Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 PE=1 SV=1
4	Q92552	8.03e-07	53.1	414	0.113	0.106	RT27_HUMAN Small ribosomal subunit protein mS27 OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3
5	Q32PI8	2.62e-06	51.6	415	0.106	0.099	RT27_BOVIN Small ribosomal subunit protein mS27 OS=Bos taurus OX=9913 GN=MRPS27 PE=1 SV=1
6	Q8BK72	8.64e-06	49.7	415	0.072	0.067	RT27_MOUSE Small ribosomal subunit protein mS27 OS=Mus musculus OX=10090 GN=Mrps27 PE=1 SV=2
7	D6RH20	1.64e-05	48.5	299	0.077	0.100	D6RH20_HUMAN Mitochondrial ribosomal protein S27 (Fragment) OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=1
8	G5EA06	2.28e-05	48.5	358	0.077	0.084	G5EA06_HUMAN Mitochondrial ribosomal protein S27 OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=1
9	Q9T0D6	0.37	35.4	566	0.072	0.049	PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana OX=3702 GN=At4g11690 PE=2 SV=1
10	Q9ZVX5	0.46	35.0	743	0.072	0.038	PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana OX=3702 GN=At2g16880 PE=2 SV=1
11	Q9S7R4	0.49	35.0	482	0.041	0.033	PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OTP43 PE=2 SV=1
12	O64624	0.72	34.7	822	0.052	0.024	PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g18940 PE=2 SV=1
13	P53271	1.2	33.1	262	0.044	0.065	COG2_YEAST Conserved oligomeric Golgi complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COG2 PE=1 SV=2
14	G5EC75	1.3	33.9	796	0.052	0.025	G5EC75_CAEEL Chloride channel protein OS=Caenorhabditis elegans OX=6239 GN=clh-6 PE=1 SV=1
15	Q9LFF1	1.3	33.5	754	0.080	0.041	PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MEE40 PE=2 SV=1
16	Q9LK57	1.5	33.1	394	0.041	0.041	PP226_ARATH Small ribosomal subunit protein mS79 (rPPR3b) OS=Arabidopsis thaliana OX=3702 GN=At3g13160 PE=1 SV=1
17	Q9SR00	1.5	33.5	602	0.057	0.037	PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g04760 PE=2 SV=1
18	Q9ZQF1	2.0	33.1	627	0.077	0.048	PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g15630 PE=3 SV=1
19	A3KPF8	2.1	33.1	576	0.044	0.030	PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g79080 PE=2 SV=1
20	O82380	2.4	32.7	738	0.046	0.024	PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H33 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10037 MRP-S27	1.2e-08	45.9	Mitochondrial 28S ribosomal protein S27
2	PF01535 PPR	1.8	20.1	PPR repeat
3	PF12854 PPR_1	14	16.8	PPR repeat
4	PF13041 PPR_2	0.0072	27.8	PPR repeat family
5	PF13812 PPR_3	7.5	18.0	Pentatricopeptide repeat domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292478	0.833	Pentatricopeptide repeat-containing protein 1, mitochondrial
2	9606.ENSP00000400168	0.829	ATP5J2-PTCD1 readthrough
3	9606.ENSP00000254630	0.811	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
4	9606.ENSP00000440915	0.742	Mitochondrial ribonuclease P catalytic subunit
5	9606.ENSP00000426941	0.710	28S ribosomal protein S27, mitochondrial
6	9606.ENSP00000260665	0.680	Leucine-rich PPR motif-containing protein, mitochondrial
7	9606.ENSP00000364126	0.662	DNA-(apurinic or apyrimidinic site) lyase 2
8	9606.ENSP00000319726	0.602	Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface . Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6
9	9606.ENSP00000312356	0.597	tRNA methyltransferase 10 homolog C
10	9606.ENSP00000477141	0.587	DOMON domain-containing protein FRRS1L
11	9606.ENSP00000373331	0.584	Mitochondrial mRNA pseudouridine synthase RPUSD3
12	9606.ENSP00000337445	0.578	Zinc phosphodiesterase ELAC protein 2
13	9606.ENSP00000358374	0.573	Protein SCAF11
14	9606.ENSP00000465759	0.550	DNA-directed RNA polymerase, mitochondrial
15	9606.ENSP00000254928	0.539	GTPase Era, mitochondrial
16	9606.ENSP00000462963	0.535	Transcription elongation factor, mitochondrial
17	9606.ENSP00000254799	0.534	G-rich sequence factor 1
18	9606.ENSP00000463287	0.518	Kruppel like factor 14
19	9606.ENSP00000318270	0.516	Prominin-2
20	9606.ENSP00000444743	0.516	Protein phosphatase Slingshot homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.941	regulation of cellular process
GO:0019222	0.932	regulation of metabolic process
GO:0071840	0.894	cellular component organization or biogenesis
GO:0060255	0.746	regulation of macromolecule metabolic process
GO:0016043	0.735	cellular component organization
GO:0006996	0.646	organelle organization
GO:0051171	0.628	regulation of nitrogen compound metabolic process
GO:0010468	0.627	regulation of gene expression
GO:0080090	0.623	regulation of primary metabolic process
GO:0031323	0.623	regulation of cellular metabolic process
GO:0008152	0.444	metabolic process
GO:0032501	0.381	multicellular organismal process
GO:0032502	0.380	developmental process
GO:0048856	0.374	anatomical structure development
GO:0071704	0.356	organic substance metabolic process
GO:0007275	0.342	multicellular organism development
GO:1903311	0.310	regulation of mRNA metabolic process
GO:0044237	0.307	cellular metabolic process
GO:0006807	0.304	nitrogen compound metabolic process
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.640	intracellular organelle lumen
GO:0043232	0.536	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]