StarFunc result for job id Q8WV99

User Input

>input (257 residues)
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSR
NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTR
SPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQ
RQQAQSRSSKPSNCSLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WV99	1.000	1.000	1.271E-48	257	1.000	1.000	Q8WV99.pdb.gz	ZFN2B_HUMAN AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B PE=1 SV=1
2	AFDB:Q9JII7	0.369	0.500	3.595E-23	171	0.358	0.538	Q9JII7.pdb.gz	ZFN2A_MOUSE AN1-type zinc finger protein 2A OS=Mus musculus OX=10090 GN=Zfand2a PE=2 SV=1
3	AFDB:Q8N6M9	0.302	0.495	3.028E-22	145	0.335	0.593	Q8N6M9.pdb.gz	ZFN2A_HUMAN AN1-type zinc finger protein 2A OS=Homo sapiens OX=9606 GN=ZFAND2A PE=1 SV=2
4	AFDB:Q9XUW8	0.294	0.366	3.140E-16	202	0.245	0.312	Q9XUW8.pdb.gz	Q9XUW8_CAEEL AN1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aip-1 PE=1 SV=1
5	AFDB:Q9SCM4	0.289	0.297	2.475E-15	249	0.233	0.241	Q9SCM4.pdb.gz	SAP13_ARATH Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13 OS=Arabidopsis thaliana OX=3702 GN=SAP13 PE=2 SV=1
6	AFDB:Q67YE6	0.270	0.357	5.604E-12	186	0.202	0.280	Q67YE6.pdb.gz	SAP12_ARATH Zinc finger AN1 domain-containing stress-associated protein 12 OS=Arabidopsis thaliana OX=3702 GN=SAP12 PE=2 SV=2
7	AFDB:Q8TCF1	0.174	0.169	3.384E-11	268	0.175	0.168	Q8TCF1.pdb.gz	ZFAN1_HUMAN AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1 PE=1 SV=1
8	AFDB:Q6DJN2	0.197	0.117	1.963E-2	556	0.152	0.070	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
9	AFDB:Q3UDK1	0.116	0.073	3.128E-2	580	0.167	0.074	Q3UDK1.pdb.gz	TRAD1_MOUSE TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus OX=10090 GN=Trafd1 PE=1 SV=1
10	AFDB:Q6PV84	0.089	0.055	3.218E-1	448	0.089	0.051	Q6PV84.pdb.gz	Q6PV84_DANRE ZIC family member 3 heterotaxy 1 (Odd-paired homolog, Drosophila) OS=Danio rerio OX=7955 GN=wu:fj52a10 PE=2 SV=1
11	PDB:7zs96	0.101	0.070	1.835	383	0.070	0.047	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
12	PDB:5z8lA	0.078	0.095	3.818	204	0.023	0.029	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
13	PDB:7egb3	0.100	0.098	4.362	263	0.039	0.038	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:7o4i1	0.144	0.084	4.662	522	0.054	0.027	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:3haxC	0.071	0.253	5.327	53	0.039	0.189	3haxC.pdb.gz	Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
16	PDB:7ena3	0.103	0.091	5.327	295	0.054	0.047	7ena3.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:5dgesM	0.078	0.186	5.694	104	0.093	0.231	5dgesM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
18	PDB:5ex0A	0.087	0.056	6.086	429	0.043	0.026	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
19	PDB:7dvqR	0.126	0.133	6.086	241	0.101	0.108	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:5v3hA	0.128	0.080	6.953	438	0.035	0.021	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WV99	0.0	524	257	1.000	1.000	ZFN2B_HUMAN AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B PE=1 SV=1
2	Q91X58	8.16e-167	463	257	0.903	0.903	ZFN2B_MOUSE AN1-type zinc finger protein 2B OS=Mus musculus OX=10090 GN=Zfand2b PE=1 SV=1
3	Q9JII7	1.08e-64	201	171	0.342	0.515	ZFN2A_MOUSE AN1-type zinc finger protein 2A OS=Mus musculus OX=10090 GN=Zfand2a PE=2 SV=1
4	Q8N6M9	3.10e-64	199	145	0.335	0.593	ZFN2A_HUMAN AN1-type zinc finger protein 2A OS=Homo sapiens OX=9606 GN=ZFAND2A PE=1 SV=2
5	Q9XUW8	1.08e-36	130	202	0.226	0.287	Q9XUW8_CAEEL AN1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aip-1 PE=1 SV=1
6	Q9SCM4	6.17e-28	109	249	0.230	0.237	SAP13_ARATH Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13 OS=Arabidopsis thaliana OX=3702 GN=SAP13 PE=2 SV=1
7	Q67YE6	1.67e-21	90.5	186	0.183	0.253	SAP12_ARATH Zinc finger AN1 domain-containing stress-associated protein 12 OS=Arabidopsis thaliana OX=3702 GN=SAP12 PE=2 SV=2
8	Q8TCF1	9.76e-13	68.6	268	0.148	0.142	ZFAN1_HUMAN AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1 PE=1 SV=1
9	P53899	1.39e-04	44.7	274	0.070	0.066	CUZ1_YEAST CDC48-associated ubiquitin-like/zinc finger protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CUZ1 PE=1 SV=1
10	Q387I5	0.014	38.9	517	0.070	0.035	Q387I5_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0435 PE=4 SV=1
11	O49663	0.17	34.7	176	0.109	0.159	SAP9_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Arabidopsis thaliana OX=3702 GN=SAP9 PE=2 SV=1
12	Q9LHJ8	0.19	34.3	160	0.086	0.138	SAP5_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 5 OS=Arabidopsis thaliana OX=3702 GN=SAP5 PE=2 SV=1
13	Q9C7N2	1.0	33.1	561	0.070	0.032	CAD1_ARATH MACPF domain-containing protein CAD1 OS=Arabidopsis thaliana OX=3702 GN=CAD1 PE=2 SV=1
14	M0RB22	2.6	32.0	1899	0.089	0.012	M0RB22_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=3
15	O42874	2.8	32.0	1462	0.113	0.020	STU1_SCHPO Protein peg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=peg1 PE=1 SV=1
16	A0A8I6AEM0	2.9	32.0	1897	0.089	0.012	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
17	Q64487	2.9	32.0	1912	0.089	0.012	PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3
18	Q9STJ9	2.9	30.4	130	0.058	0.115	SAP10_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 10 OS=Arabidopsis thaliana OX=3702 GN=SAP10 PE=1 SV=1
19	A0A8I6A1V1	3.0	32.0	1912	0.089	0.012	A0A8I6A1V1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
20	Q86WR3	3.8	31.2	653	0.089	0.035	Q86WR3_HUMAN ANUBL1 protein OS=Homo sapiens OX=9606 GN=ANUBL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04236 Transp_Tc5_C	1.2	20.9	Tc5 transposase C-terminal domain
2	PF02809 UIM	0.25	22.3	Ubiquitin interaction motif
3	PF01428 zf-AN1	8.7e-17	72.3	AN1-like Zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.972	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000448051	0.858	DAZ associated protein 2
3	9606.ENSP00000362061	0.817	Oxidative stress-responsive serine-rich protein 1
4	9606.ENSP00000311665	0.774	Proteasomal ATPase-associated factor 1
5	9606.ENSP00000418695	0.750	Proteasome 26S subunit, non-ATPase 6
6	9606.ENSP00000401802	0.696	26S proteasome regulatory subunit 10B
7	9606.ENSP00000331487	0.684	Nuclear protein localization protein 4 homolog
8	9606.ENSP00000224073	0.660	Endothelial differentiation-related factor 1
9	9606.ENSP00000263202	0.658	Ubiquitin recognition factor in ER-associated degradation protein 1
10	9606.ENSP00000327323	0.654	Threonine synthase-like 2
11	9606.ENSP00000347498	0.621	Abscission/NoCut checkpoint regulator
12	9606.ENSP00000263672	0.617	Signal peptidase complex subunit 2
13	9606.ENSP00000310572	0.617	26S proteasome regulatory subunit 8
14	9606.ENSP00000339484	0.615	Zinc finger AN1-type containing 4
15	9606.ENSP00000365576	0.604	Ubiquilin-1
16	9606.ENSP00000261208	0.597	Histidine ammonia-lyase
17	9606.ENSP00000357292	0.594	Ubiquilin-4
18	9606.ENSP00000261942	0.586	FAS-associated factor 2
19	9606.ENSP00000338039	0.579	Proteasome inhibitor PI31 subunit
20	9606.ENSP00000157812	0.576	26S proteasome regulatory subunit 6B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036435	1.000	K48-linked polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0070972	0.987	protein localization to endoplasmic reticulum
GO:0019538	0.985	protein metabolic process
GO:0045047	0.983	protein targeting to ER
GO:0006508	0.957	proteolysis
GO:0043161	0.954	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0050789	0.866	regulation of biological process
GO:0050794	0.815	regulation of cellular process
GO:0048583	0.373	regulation of response to stimulus
GO:0050896	0.348	response to stimulus
GO:0055085	0.318	transmembrane transport
GO:0065002	0.314	intracellular protein transmembrane transport
GO:0006612	0.314	protein targeting to membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000502	0.999	proteasome complex
GO:0016020	0.984	membrane
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0012505	0.975	endomembrane system
GO:0005737	0.972	cytoplasm
GO:0005783	0.716	endoplasmic reticulum
GO:0031981	0.564	nuclear lumen
GO:0005654	0.540	nucleoplasm
GO:0005829	0.477	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]