StarFunc result for job id Q8WVB6

User Input

>input (975 residues)
MEDYEQELCGVEDDFHNQFAAELEVLAELEGASTPSPSGVPLFTAGRPPRTFEEALARGD
AASSPAPAASVGSSQGGARKRQVDADLQPAGSLPHAPRIKRPRLQVVKRLNFRSEEMEEP
PPPDSSPTDITPPPSPEDLAELWGHGVSEAAADVGLTRASPAARNPVLRRPPILEDYVHV
TSTEGVRAYLVLRADPMAPGVQGSLLHVPWRGGGQLDLLGVSLASLKKQVDGERRERLLQ
EAQKLSDTLHSLRSGEEEAAQPLGAPEEEPTDGQDASSHCLWVDEFAPRHYTELLSDDFT
NRCLLKWLKLWDLVVFGHERPSRKPRPSVEPARVSKEATAPGKWKSHEQVLEEMLEAGLD
PSQRPKQKVALLCGPPGLGKTTLAHVIARHAGYSVVEMNASDDRSPEVFRTRIEAATQME
SVLGAGGKPNCLVIDEIDGAPVAAINVLLSILNRKGPQEVGPQGPAVPSGGGRRRRAEGG
LLMRPIICICNDQFAPSLRQLKQQAFLLHFPPTLPSRLVQRLQEVSLRQGMRADPGVLAA
LCEKTDNDIRACINTLQFLYSRGQRELSVRDVQATRVGLKDQRRGLFSVWQEVFQLPRAQ
RRRVGQDPALPADTLLLGDGDAGSLTSASQRFYRVLHAAASAGEHEKVVQGLFDNFLRLR
LRDSSLGAVCVALDWLAFDDLLAGAAHHSQSFQLLRYPPFLPVAFHVLFASSHTPRITFP
SSQQEAQNRMSQMRNLIQTLVSGIAPATRSRATPQALLLDALCLLLDILAPKLRPVSTQL
YSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT
KQLIAREIEVEKMRRAEASARVENSPQVDGSPPGLEGLLGGIGEKGVHRPAPRNHEQRLE
HIMRRAAREEQPEKDFFGRVVVRSTAVPSAGDTAPEQDSVERRMGTAVGRSEVWFRFNEG
VSNAVRRSLYIRDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BIW9	0.744	0.748	0.000	969	0.753	0.757	Q8BIW9.pdb.gz	CTF18_MOUSE Chromosome transmission fidelity protein 18 homolog OS=Mus musculus OX=10090 GN=Chtf18 PE=1 SV=2
2	AFDB:P35251	0.408	0.351	1.523E-23	1148	0.160	0.136	P35251.pdb.gz	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
3	PDB:8dr5A	0.377	0.544	1.233E-19	646	0.117	0.176	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
4	PDB:7tfkA	0.309	0.769	2.524E-13	360	0.085	0.231	7tfkA.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
5	PDB:7z6hD	0.224	0.590	2.327E-10	324	0.079	0.238	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
6	PDB:7z6hK	0.301	0.609	2.580E-10	439	0.096	0.214	7z6hK.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
7	PDB:6vvoB	0.215	0.578	3.173E-10	316	0.064	0.196	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
8	PDB:7tfhB	0.237	0.622	3.341E-10	320	0.068	0.206	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
9	PDB:8dqxC	0.219	0.557	6.545E-10	330	0.072	0.212	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
10	PDB:8dr0D	0.209	0.511	4.670E-9	344	0.063	0.177	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
11	PDB:3u5zB	0.204	0.514	5.179E-9	320	0.055	0.169	3u5zB.pdb.gz	How a DNA polymerase clamp loader opens a sliding clamp.
12	PDB:8dqwE	0.221	0.531	2.444E-8	354	0.058	0.161	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
13	AFDB:Q8LMR2	0.099	0.061	9.811E-4	1883	0.134	0.070	Q8LMR2.pdb.gz	DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DCL1 PE=3 SV=1
14	AFDB:Q9Y794	0.162	0.163	1.271E-3	972	0.091	0.092	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
15	AFDB:P43564	0.053	0.050	3.764E-3	1073	0.137	0.125	P43564.pdb.gz	MIL1_YEAST Probable lipase MIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIL1 PE=1 SV=2
16	AFDB:P46468	0.127	0.104	3.764E-3	1229	0.076	0.060	P46468.pdb.gz	CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF07_0047 PE=3 SV=2
17	AFDB:F4JAU2	0.066	0.044	4.396E-3	1697	0.122	0.070	F4JAU2.pdb.gz	SAC3B_ARATH SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1
18	AFDB:A0A140VJR0	0.062	0.069	1.115E-2	809	0.125	0.151	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
19	AFDB:Q9FNM7	0.084	0.093	2.184E-2	850	0.080	0.092	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
20	AFDB:Q9HGP4	0.066	0.077	3.303E-2	727	0.115	0.154	Q9HGP4.pdb.gz	YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC631.02 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SF58	0.0	1865	1184	0.971	0.800	A0A0D9SF58_HUMAN Chromosome transmission fidelity factor 18 OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1
2	E7EXA6	0.0	1971	975	0.999	0.999	E7EXA6_HUMAN Chromosome transmission fidelity factor 18 OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=2
3	Q8BIW9	0.0	1368	969	0.759	0.764	CTF18_MOUSE Chromosome transmission fidelity protein 18 homolog OS=Mus musculus OX=10090 GN=Chtf18 PE=1 SV=2
4	Q8WVB6	0.0	1973	975	1.000	1.000	CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1
5	Q8IQ05	2.34e-151	476	993	0.286	0.281	CTF18_DROME Chromosome transmission fidelity protein 18 homolog OS=Drosophila melanogaster OX=7227 GN=cutlet PE=2 SV=2
6	F4I5S3	1.64e-93	319	943	0.246	0.255	F4I5S3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CTF18 PE=1 SV=1
7	Q9USQ1	2.70e-65	240	960	0.195	0.198	CTF18_SCHPO Chromosome transmission fidelity protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf18 PE=1 SV=1
8	P49956	1.50e-46	181	741	0.189	0.248	CTF18_YEAST Chromosome transmission fidelity protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTF18 PE=1 SV=1
9	Q57Y55	3.45e-43	172	993	0.159	0.156	Q57Y55_TRYB2 AAA+ ATPase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.550 PE=4 SV=1
10	A0A0G2JVK8	1.84e-22	106	1127	0.109	0.094	A0A0G2JVK8_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=2
11	Q9Z2R7	7.68e-22	104	1104	0.108	0.095	Q9Z2R7_RAT Replication factor C subunit 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=2 SV=1
12	D3ZFT1	7.93e-22	104	1145	0.104	0.088	D3ZFT1_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=3
13	O60182	8.12e-22	104	934	0.074	0.077	RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc1 PE=1 SV=1
14	P35251	2.25e-20	99.8	1148	0.094	0.080	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
15	P35601	2.43e-20	99.8	1131	0.089	0.077	RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus OX=10090 GN=Rfc1 PE=1 SV=2
16	P35600	5.04e-20	98.6	986	0.084	0.083	RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster OX=7227 GN=Gnf1 PE=1 SV=2
17	P38630	8.18e-18	91.3	861	0.061	0.069	RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC1 PE=1 SV=1
18	Q385K3	9.19e-15	80.9	587	0.070	0.116	Q385K3_TRYB2 Replication factor C, subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3360 PE=3 SV=1
19	Q9C587	2.86e-08	60.5	956	0.058	0.060	RFC1_ARATH Replication factor C subunit 1 OS=Arabidopsis thaliana OX=3702 GN=RFC1 PE=2 SV=1
20	Q38DH5	1.42e-07	57.0	357	0.062	0.168	Q38DH5_TRYB2 Replication factor C, subunit 3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3310 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.4e-08	46.7	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	5.5	18.4	AAA domain
3	PF13191 AAA_16	3	19.7	AAA ATPase domain
4	PF13207 AAA_17	78	15.1	AAA domain
5	PF13238 AAA_18	29	16.6	AAA domain
6	PF13245 AAA_19	69	15.1	AAA domain
7	PF13401 AAA_22	0.0035	29.1	AAA domain
8	PF13481 AAA_25	29	15.7	AAA domain
9	PF13521 AAA_28	1e+02	14.5	AAA domain
10	PF07726 AAA_3	6.3e+02	11.6	ATPase family associated with various cellular activities (AAA)
11	PF13604 AAA_30	60	14.8	AAA domain
12	PF13671 AAA_33	1.4	20.5	AAA domain
13	PF07728 AAA_5	7.6e-07	40.7	AAA domain (dynein-related subfamily)
14	PF12775 AAA_7	3e+02	12.3	P-loop containing dynein motor region
15	PF00005 ABC_tran	1.2e+02	14.6	ABC transporter
16	PF06144 DNA_pol3_delta	7.5	17.8	DNA polymerase III, delta subunit
17	PF01695 IstB_IS21	1.1e+02	13.7	IstB-like ATP binding protein
18	PF00931 NB-ARC	5.2e+02	11.2	NB-ARC domain
19	PF03215 Rad17	0.1	24.1	Rad17 P-loop domain
20	PF05496 RuvB_N	0.017	26.3	Holliday junction DNA helicase RuvB P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000055077	0.999	Replication factor C subunit 2
2	9606.ENSP00000322180	0.999	Sister chromatid cohesion protein DCC1
3	9606.ENSP00000369411	0.999	Replication factor C subunit 3
4	9606.ENSP00000376272	0.999	Replication factor C subunit 4
5	9606.ENSP00000408295	0.997	Replication factor C subunit 5
6	9606.ENSP00000408367	0.996	Chromosome transmission fidelity protein 8 homolog
7	9606.ENSP00000322570	0.995	DNA polymerase epsilon catalytic subunit A
8	9606.ENSP00000353793	0.992	WD repeat and HMG-box DNA-binding protein 1
9	9606.ENSP00000368349	0.991	DNA polymerase alpha catalytic subunit
10	9606.ENSP00000368458	0.985	Proliferating cell nuclear antigen
11	9606.ENSP00000440402	0.985	ATP-dependent DNA helicase DDX11
12	9606.ENSP00000216367	0.982	DNA polymerase epsilon subunit 2
13	9606.ENSP00000265465	0.982	DNA polymerase alpha subunit B
14	9606.ENSP00000484105	0.977	DNA primase large subunit
15	9606.ENSP00000426191	0.976	Cell cycle checkpoint protein RAD17
16	9606.ENSP00000269214	0.972	N-acetyltransferase ESCO1
17	9606.ENSP00000371321	0.971	Replication factor C subunit 1
18	9606.ENSP00000450607	0.966	Protein timeless homolog
19	9606.ENSP00000354720	0.963	Structural maintenance of chromosomes protein 3
20	9606.ENSP00000306999	0.956	N-acetyltransferase ESCO2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003678	0.999	DNA helicase activity
GO:0017116	0.983	single-stranded DNA helicase activity
GO:0097159	0.827	organic cyclic compound binding
GO:1901363	0.825	heterocyclic compound binding
GO:0003689	0.387	DNA clamp loader activity
GO:0003676	0.356	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0048518	0.978	positive regulation of biological process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0051052	0.973	regulation of DNA metabolic process
GO:0051173	0.960	positive regulation of nitrogen compound metabolic process
GO:0050790	0.920	regulation of catalytic activity
GO:0048522	0.920	positive regulation of cellular process
GO:2000278	0.906	regulation of DNA biosynthetic process
GO:0009987	0.885	cellular process
GO:0071704	0.825	organic substance metabolic process
GO:0044093	0.825	positive regulation of molecular function
GO:0044238	0.822	primary metabolic process
GO:0006807	0.808	nitrogen compound metabolic process
GO:0044237	0.802	cellular metabolic process
GO:0031325	0.794	positive regulation of cellular metabolic process
GO:0051338	0.793	regulation of transferase activity
GO:0043170	0.786	macromolecule metabolic process
GO:0043085	0.784	positive regulation of catalytic activity
GO:0006259	0.770	DNA metabolic process
GO:2000573	0.743	positive regulation of DNA biosynthetic process
GO:0071840	0.738	cellular component organization or biogenesis
GO:0016043	0.717	cellular component organization
GO:0051347	0.694	positive regulation of transferase activity
GO:0006996	0.624	organelle organization
GO:0006275	0.600	regulation of DNA replication
GO:0022402	0.590	cell cycle process
GO:0048519	0.573	negative regulation of biological process
GO:0048523	0.554	negative regulation of cellular process
GO:0051726	0.501	regulation of cell cycle
GO:0010564	0.435	regulation of cell cycle process
GO:0090329	0.418	regulation of DNA-templated DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0043228	0.985	non-membrane-bounded organelle
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0032991	0.976	protein-containing complex
GO:0005694	0.921	chromosome
GO:0140513	0.676	nuclear protein-containing complex
GO:0016020	0.578	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]