StarFunc result for job id Q8WVD5

User Input

>input (230 residues)
MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHL
LFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQ
SSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDK
WSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WVD5	1.000	1.000	2.198E-43	230	1.000	1.000	Q8WVD5.pdb.gz	RN141_HUMAN RING finger protein 141 OS=Homo sapiens OX=9606 GN=RNF141 PE=1 SV=1
2	AFDB:Q9M022	0.259	0.247	5.716E-8	242	0.174	0.165	Q9M022.pdb.gz	AIRP2_ARATH E3 ubiquitin-protein ligase AIRP2 OS=Arabidopsis thaliana OX=3702 GN=AIRP2 PE=1 SV=1
3	AFDB:Q8L8N5	0.238	0.228	1.318E-7	242	0.178	0.169	Q8L8N5.pdb.gz	Q8L8N5_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATAIRP4 PE=2 SV=1
4	AFDB:Q9W0D7	0.217	0.169	7.575E-4	299	0.126	0.097	Q9W0D7.pdb.gz	Q9W0D7_DROME GM14467p OS=Drosophila melanogaster OX=7227 GN=Pex10 PE=2 SV=1
5	AFDB:Q9VSK2	0.229	0.065	8.041E-4	878	0.174	0.046	Q9VSK2.pdb.gz	Q9VSK2_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=2
6	AFDB:Q9VJ14	0.246	0.059	1.021E-3	1049	0.083	0.018	Q9VJ14.pdb.gz	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
7	AFDB:D3ZUV2	0.243	0.059	1.084E-3	1006	0.109	0.025	D3ZUV2.pdb.gz	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
8	AFDB:Q6TEM9	0.240	0.123	1.747E-3	472	0.157	0.076	Q6TEM9.pdb.gz	MYLIA_DANRE E3 ubiquitin-protein ligase MYLIP-A OS=Danio rerio OX=7955 GN=mylipa PE=1 SV=2
9	AFDB:Q9VZJ9	0.210	0.146	1.747E-3	338	0.126	0.086	Q9VZJ9.pdb.gz	MUL1_DROME Mitochondrial E3 ubiquitin protein ligase 1 OS=Drosophila melanogaster OX=7227 GN=Mul1 PE=1 SV=1
10	AFDB:Q8BM54	0.238	0.130	1.969E-3	445	0.139	0.072	Q8BM54.pdb.gz	MYLIP_MOUSE E3 ubiquitin-protein ligase MYLIP OS=Mus musculus OX=10090 GN=Mylip PE=1 SV=1
11	PDB:5gm6a	0.194	0.343	3.047E-2	123	0.070	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:2hqsA	0.168	0.102	8.408E-2	412	0.061	0.034	2hqsA.pdb.gz
13	PDB:7oikA	0.212	0.018	9.474E-2	4426	0.135	0.007	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
14	PDB:5dkaA	0.170	0.384	1.721E-1	96	0.065	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:1jcfA	0.138	0.103	2.614E-1	336	0.039	0.027	1jcfA.pdb.gz
16	PDB:1hjrA	0.130	0.175	2.775E-1	158	0.052	0.076	1hjrA.pdb.gz
17	PDB:1n3gA	0.156	0.252	2.775E-1	113	0.078	0.159	1n3gA.pdb.gz
18	PDB:2wp8B	0.170	0.178	3.126E-1	217	0.039	0.041	2wp8B.pdb.gz
19	PDB:5hfuB	0.120	0.043	3.740E-1	897	0.087	0.022	5hfuB.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
20	PDB:6vq6H	0.112	0.120	4.473E-1	214	0.078	0.084	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WVD5	6.97e-175	481	230	1.000	1.000	RN141_HUMAN RING finger protein 141 OS=Homo sapiens OX=9606 GN=RNF141 PE=1 SV=1
2	Q99MB7	1.98e-173	477	230	0.991	0.991	RN141_MOUSE RING finger protein 141 OS=Mus musculus OX=10090 GN=Rnf141 PE=1 SV=2
3	Q8RXD3	3.08e-07	52.4	310	0.096	0.071	AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana OX=3702 GN=AIP2 PE=1 SV=1
4	Q9M022	5.15e-07	51.2	242	0.100	0.095	AIRP2_ARATH E3 ubiquitin-protein ligase AIRP2 OS=Arabidopsis thaliana OX=3702 GN=AIRP2 PE=1 SV=1
5	Q8SX72	8.94e-07	51.6	868	0.096	0.025	Q8SX72_DROME LD30050p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=1
6	Q9VHC2	1.39e-06	50.8	1173	0.096	0.019	Q9VHC2_DROME GH10160p OS=Drosophila melanogaster OX=7227 GN=mura PE=2 SV=4
7	Q9XI67	1.95e-06	48.9	179	0.104	0.134	Q9XI67_ARATH At1g14200 OS=Arabidopsis thaliana OX=3702 GN=At1g14200 PE=2 SV=1
8	Q8NC42	2.02e-06	50.1	400	0.100	0.058	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
9	Q7XLY8	2.65e-06	49.7	383	0.091	0.055	ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0590900 PE=2 SV=2
10	Q3U2C5	3.33e-06	49.3	394	0.100	0.058	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
11	O76064	3.44e-06	49.3	485	0.100	0.047	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
12	Q9C9X1	3.98e-06	48.9	343	0.091	0.061	Q9C9X1_ARATH At1g68070 OS=Arabidopsis thaliana OX=3702 GN=At1g68070 PE=1 SV=1
13	Q6ABG8	5.56e-06	48.9	523	0.135	0.059	Q6ABG8_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
14	Q9ULK6	5.70e-06	48.9	438	0.083	0.043	RN150_HUMAN RING finger protein 150 OS=Homo sapiens OX=9606 GN=RNF150 PE=1 SV=2
15	Q8L8N5	5.98e-06	48.1	242	0.091	0.087	Q8L8N5_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATAIRP4 PE=2 SV=1
16	Q95ZR5	6.54e-06	48.5	565	0.135	0.055	Q95ZR5_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
17	Q19019	7.10e-06	48.5	582	0.135	0.053	Q19019_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
18	Q06003	7.88e-06	48.5	461	0.087	0.043	GOLI_DROME E3 ubiquitin-protein ligase goliath OS=Drosophila melanogaster OX=7227 GN=gol PE=1 SV=3
19	Q8VC56	1.11e-05	48.1	488	0.100	0.047	RNF8_MOUSE E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1
20	Q86XS8	1.38e-05	47.8	419	0.096	0.053	GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens OX=9606 GN=RNF130 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.14	23.4	Prokaryotic RING finger family 4
2	PF00097 zf-C3HC4	0.0062	27.7	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	6e-05	34.1	Zinc finger, C3HC4 type (RING finger)
4	PF13920 zf-C3HC4_3	1.5e-06	39.3	Zinc finger, C3HC4 type (RING finger)
5	PF15227 zf-C3HC4_4	2.2e+02	13.4	zinc finger of C3HC4-type, RING
6	PF12678 zf-rbx1	1.2	20.8	RING-H2 zinc finger domain
7	PF13639 zf-RING_2	1.2e-05	36.9	Ring finger domain
8	PF14634 zf-RING_5	0.84	21.0	zinc-RING finger domain
9	PF13445 zf-RING_UBOX	0.0046	28.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021359

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001829	0.693	Transmembrane channel-like 3
2	61853.ENSNLEP00000020827	0.605	Stomatin
3	61853.ENSNLEP00000011374	0.522	Myelin basic protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0019538	0.983	protein metabolic process
GO:0050789	0.982	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0036211	0.965	protein modification process
GO:0016567	0.964	protein ubiquitination
GO:0051865	0.940	protein autoubiquitination
GO:0019222	0.841	regulation of metabolic process
GO:0060255	0.815	regulation of macromolecule metabolic process
GO:0080090	0.795	regulation of primary metabolic process
GO:0051171	0.795	regulation of nitrogen compound metabolic process
GO:0031323	0.790	regulation of cellular metabolic process
GO:0010468	0.674	regulation of gene expression
GO:0009889	0.661	regulation of biosynthetic process
GO:0019219	0.645	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.628	regulation of RNA metabolic process
GO:0010556	0.599	regulation of macromolecule biosynthetic process
GO:0031326	0.599	regulation of cellular biosynthetic process
GO:0009987	0.578	cellular process
GO:2001141	0.560	regulation of RNA biosynthetic process
GO:1903506	0.453	regulation of nucleic acid-templated transcription
GO:0006355	0.412	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.997	organelle
GO:0043227	0.985	membrane-bounded organelle
GO:0005829	0.947	cytosol
GO:0043229	0.896	intracellular organelle
GO:0043231	0.886	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]