StarFunc result for job id Q8WVF2

User Input

>input (138 residues)
MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKR
RGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWR
QWHYDGLHPSYLYNRHHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WVF2	1.000	1.000	9.149E-22	138	1.000	1.000	Q8WVF2.pdb.gz	UCMA_HUMAN Unique cartilage matrix-associated protein OS=Homo sapiens OX=9606 GN=UCMA PE=2 SV=2
2	AFDB:Q14BU0	0.623	0.623	5.735E-16	138	0.790	0.790	Q14BU0.pdb.gz	UCMA_MOUSE Unique cartilage matrix-associated protein OS=Mus musculus OX=10090 GN=Ucma PE=1 SV=1
3	AFDB:Q6NWB6	0.610	0.621	3.242E-11	135	0.493	0.504	Q6NWB6.pdb.gz	UCMA_DANRE Unique cartilage matrix-associated protein OS=Danio rerio OX=7955 GN=ucma PE=2 SV=1
4	AFDB:Q9LT23	0.308	0.152	2.310	337	0.188	0.077	Q9LT23.pdb.gz	BH121_ARATH Transcription factor bHLH121 OS=Arabidopsis thaliana OX=3702 GN=BHLH121 PE=1 SV=1
5	PDB:5b3dB	0.209	0.241	2.845	117	0.116	0.137	5b3dB.pdb.gz
6	AFDB:Q8W2F2	0.251	0.146	3.151	286	0.196	0.094	Q8W2F2.pdb.gz	BH011_ARATH Transcription factor bHLH11 OS=Arabidopsis thaliana OX=3702 GN=BHLH11 PE=2 SV=2
7	AFDB:P39428	0.265	0.105	3.977	409	0.188	0.064	P39428.pdb.gz	TRAF1_MOUSE TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2
8	AFDB:Q6AW08	0.246	0.056	5.863	794	0.152	0.026	Q6AW08.pdb.gz	Q6AW08_CAEEL Conserved oligomeric Golgi complex subunit 3 OS=Caenorhabditis elegans OX=6239 GN=cogc-3 PE=1 SV=1
9	AFDB:C0H4M0	0.253	0.060	6.847	861	0.130	0.021	C0H4M0.pdb.gz	C0H4M0_PLAF7 Rhoptry-associated membrane antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0707300 PE=4 SV=1
10	AFDB:Q6W0C5	0.148	0.128	6.847	159	0.072	0.063	Q6W0C5.pdb.gz	DPPA3_HUMAN Developmental pluripotency-associated protein 3 OS=Homo sapiens OX=9606 GN=DPPA3 PE=1 SV=1
11	AFDB:Q9VKK5	0.217	0.235	7.400	122	0.145	0.164	Q9VKK5.pdb.gz	Q9VKK5_DROME Allatostatin C, isoform A OS=Drosophila melanogaster OX=7227 GN=AstC PE=1 SV=1
12	PDB:6uxvG	0.361	0.273	8.433	197	0.130	0.091	6uxvG.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WVF2	1.57e-100	285	138	1.000	1.000	UCMA_HUMAN Unique cartilage matrix-associated protein OS=Homo sapiens OX=9606 GN=UCMA PE=2 SV=2
2	Q14BU0	1.23e-60	184	138	0.790	0.790	UCMA_MOUSE Unique cartilage matrix-associated protein OS=Mus musculus OX=10090 GN=Ucma PE=1 SV=1
3	Q6NWB6	2.84e-45	145	135	0.500	0.511	UCMA_DANRE Unique cartilage matrix-associated protein OS=Danio rerio OX=7955 GN=ucma PE=2 SV=1
4	Q9VJL5	0.40	32.3	570	0.152	0.037	Q9VJL5_DROME Crossover suppressor on 2 of manheim OS=Drosophila melanogaster OX=7227 GN=c(2)M PE=2 SV=2
5	Q9SKB3	1.2	31.2	548	0.188	0.047	PARG1_ARATH Poly(ADP-ribose) glycohydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=PARG1 PE=1 SV=2
6	Q9U1M8	1.6	30.8	2357	0.145	0.008	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
7	X5M5N0	1.9	30.8	1850	0.152	0.011	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
8	O94414	2.2	30.0	334	0.167	0.069	LNP_SCHPO Endoplasmic reticulum junction formation protein lunapark OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lnp1 PE=1 SV=1
9	Q8ILY1	2.5	30.4	2016	0.152	0.010	Q8ILY1_PLAF7 Plastid replication-repair enzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1411400 PE=1 SV=1
10	Q68FQ5	3.2	30.0	727	0.123	0.023	Q68FQ5_RAT Mitochondrial translational initiation factor 2 OS=Rattus norvegicus OX=10116 GN=Mtif2 PE=1 SV=1
11	E7F350	6.2	29.3	995	0.123	0.017	E7F350_DANRE DIS3-like exonuclease 2 OS=Danio rerio OX=7955 GN=dis3l2 PE=1 SV=1
12	A6H5Y3	7.1	28.9	1253	0.109	0.012	METH_MOUSE Methionine synthase OS=Mus musculus OX=10090 GN=Mtr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01177 Asp_Glu_race	4e+02	12.2	Asp/Glu/Hydantoin racemase
2	PF06936 Selenoprotein_S	2.2e+02	13.1	Selenoprotein S (SelS)
3	PF17085 UCMA	3.4e-74	258.7	Unique cartilage matrix associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367952

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360493	0.922	Runt-related transcription factor 2
2	9606.ENSP00000443827	0.920	Transcription factor Sp7
3	9606.ENSP00000415151	0.900	Core-binding factor subunit beta
4	9606.ENSP00000278937	0.748	Myelin protein zero-like protein 2
5	9606.ENSP00000371693	0.642	Tumor necrosis factor receptor superfamily member 19
6	9606.ENSP00000432487	0.543	Protein SAAL1
7	9606.ENSP00000351190	0.514	Inter-alpha-trypsin inhibitor heavy chain H2
8	9606.ENSP00000347041	0.501	Fibromodulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036122	1.000	BMP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0032502	0.969	developmental process
GO:0032501	0.967	multicellular organismal process
GO:0048519	0.837	negative regulation of biological process
GO:0023051	0.799	regulation of signaling
GO:0010646	0.798	regulation of cell communication
GO:0048523	0.793	negative regulation of cellular process
GO:0050793	0.693	regulation of developmental process
GO:0048583	0.671	regulation of response to stimulus
GO:0045595	0.602	regulation of cell differentiation
GO:0009966	0.537	regulation of signal transduction
GO:0048585	0.527	negative regulation of response to stimulus
GO:0023057	0.518	negative regulation of signaling
GO:0048518	0.400	positive regulation of biological process
GO:0045667	0.373	regulation of osteoblast differentiation
GO:0001649	0.304	osteoblast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.999	cytoplasm
GO:0071944	0.998	cell periphery
GO:0031012	0.989	extracellular matrix
GO:0043227	0.934	membrane-bounded organelle
GO:0070013	0.852	intracellular organelle lumen
GO:0043231	0.824	intracellular membrane-bounded organelle
GO:0005615	0.400	extracellular space
GO:0012505	0.384	endomembrane system
GO:0016020	0.309	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]