StarFunc result for job id Q8WVJ9

User Input

>input (160 residues)
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQS
FEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQV
LQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1MB48	0.539	0.539	1.282E-19	160	1.000	1.000	A1MB48.pdb.gz
2	AFDB:P13903	0.848	0.820	1.046E-17	166	0.800	0.771	P13903.pdb.gz	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
3	AFDB:Q568M7	0.743	0.709	1.783E-17	169	0.806	0.763	Q568M7.pdb.gz	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
4	AFDB:Q9PTE3	0.533	0.503	2.651E-15	171	0.819	0.766	Q9PTE3.pdb.gz	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
5	AFDB:P26687	0.520	0.413	1.605E-14	206	0.825	0.641	P26687.pdb.gz	TWST1_MOUSE Twist-related protein 1 OS=Mus musculus OX=10090 GN=Twist1 PE=1 SV=1
6	AFDB:Q32PV5	0.382	0.348	6.198E-5	176	0.306	0.278	Q32PV5.pdb.gz	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
7	AFDB:Q90690	0.373	0.281	7.571E-5	216	0.306	0.227	Q90690.pdb.gz	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
8	AFDB:P10627	0.468	0.162	8.651E-5	490	0.438	0.143	P10627.pdb.gz	TWIST_DROME Protein twist OS=Drosophila melanogaster OX=7227 GN=twi PE=1 SV=2
9	AFDB:P57102	0.387	0.300	1.130E-4	208	0.306	0.236	P57102.pdb.gz	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
10	AFDB:Q12870	0.404	0.328	1.380E-4	199	0.287	0.231	Q12870.pdb.gz	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
11	PDB:6lo8E	0.177	0.325	3.295	80	0.069	0.138	6lo8E.pdb.gz
12	PDB:2y7hB	0.171	0.061	7.842	529	0.087	0.026	2y7hB.pdb.gz	The Structure of M.Ecoki Type I DNA Methyltransferase with a DNA Mimic Antirestriction Protein.
13	PDB:7exdR	0.097	0.065	8.382	272	0.056	0.033	7exdR.pdb.gz	Structural basis for recognition of anti-migraine drug lasmiditan by the serotonin receptor 5-HT 1F -G protein complex.
14	PDB:7qsdA	0.158	0.202	8.382	115	0.056	0.078	7qsdA.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
15	PDB:7vghB	0.152	0.027	8.960	1183	0.094	0.013	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97831	1.00e-116	328	160	1.000	1.000	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
2	Q8WVJ9	1.00e-116	328	160	1.000	1.000	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
3	Q9D030	2.97e-116	327	160	0.994	0.994	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
4	Q9PTE3	2.04e-83	244	171	0.819	0.766	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
5	Q568M7	2.10e-83	244	169	0.812	0.769	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
6	P13903	1.56e-76	227	166	0.812	0.783	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
7	Q9PVG4	1.81e-72	218	190	0.762	0.642	Q9PVG4_CHICK CTwist OS=Gallus gallus OX=9031 GN=TWIST1 PE=2 SV=1
8	Q9EPJ1	4.95e-71	214	203	0.775	0.611	Q9EPJ1_RAT Twist-related protein 1 OS=Rattus norvegicus OX=10116 GN=Twist1 PE=1 SV=1
9	P26687	1.56e-70	213	206	0.775	0.602	TWST1_MOUSE Twist-related protein 1 OS=Mus musculus OX=10090 GN=Twist1 PE=1 SV=1
10	Q15672	7.15e-70	211	202	0.769	0.609	TWST1_HUMAN Twist-related protein 1 OS=Homo sapiens OX=9606 GN=TWIST1 PE=1 SV=1
11	P10627	1.83e-27	108	490	0.362	0.118	TWIST_DROME Protein twist OS=Drosophila melanogaster OX=7227 GN=twi PE=1 SV=2
12	Q11094	2.53e-18	79.3	178	0.269	0.242	TWIST_CAEEL Twist-related protein OS=Caenorhabditis elegans OX=6239 GN=hlh-8 PE=1 SV=2
13	Q62282	2.66e-15	69.7	108	0.219	0.324	TAL2_MOUSE T-cell acute lymphocytic leukemia protein 2 homolog OS=Mus musculus OX=10090 GN=Tal2 PE=4 SV=1
14	Q498R2	4.75e-15	70.9	179	0.312	0.279	Q498R2_RAT Transcription factor 21 OS=Rattus norvegicus OX=10116 GN=Tcf21 PE=4 SV=1
15	Q7ZSX3	4.99e-15	72.0	265	0.231	0.140	PTF1A_DANRE Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1
16	O35437	5.00e-15	70.5	179	0.312	0.279	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
17	Q7RTS3	5.71e-15	72.8	328	0.231	0.113	PTF1A_HUMAN Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1
18	Q64305	6.23e-15	72.4	326	0.231	0.113	PTF1A_RAT Pancreas transcription factor 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Ptf1a PE=1 SV=1
19	Q9QX98	6.93e-15	72.4	324	0.231	0.114	PTF1A_MOUSE Pancreas transcription factor 1 subunit alpha OS=Mus musculus OX=10090 GN=Ptf1a PE=1 SV=1
20	Q16559	1.03e-14	68.2	108	0.212	0.315	TAL2_HUMAN T-cell acute lymphocytic leukemia protein 2 OS=Homo sapiens OX=9606 GN=TAL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05600 CDK5RAP3	68	13.6	CDK5 regulatory subunit-associated protein 3
2	PF12466 GDH_N	1.6e+02	13.9	Glutamate dehydrogenase N terminal
3	PF00010 HLH	9e-12	56.1	Helix-loop-helix DNA-binding domain
4	PF18558 HTH_51	8.9	17.6	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9940.ENSOARP00000000253

Rank	PPI partner	STRING score	Description
1	9940.ENSOARP00000020204	0.848	CD44 molecule (Indian blood group)
2	9940.ENSOARP00000010457	0.804	Twist family bHLH transcription factor 1
3	9940.ENSOARP00000010597	0.801	Zinc finger E-box binding homeobox 2
4	9940.ENSOARP00000014995	0.794	Zinc finger E-box binding homeobox 1
5	9940.ENSOARP00000022433	0.786	Transcription factor 12
6	9940.ENSOARP00000013391	0.741	Transcription factor 3
7	9940.ENSOARP00000005381	0.728	Transcription factor 4
8	9940.ENSOARP00000011107	0.727	Runt-related transcription factor
9	9940.ENSOARP00000013952	0.725	Snail family transcriptional repressor 2
10	9940.ENSOARP00000014113	0.710	Snail family zinc finger 1
11	9940.ENSOARP00000011239	0.680	Spartin
12	9940.ENSOARP00000005431	0.650	SET domain containing 2
13	9940.ENSOARP00000001518	0.642	REL proto-oncogene, NF-kB subunit
14	9940.ENSOARP00000011554	0.618	Protein Wnt
15	9940.ENSOARP00000003083	0.614	Uncharacterized protein
16	9940.ENSOARP00000006459	0.588	SIX homeobox 2
17	9940.ENSOARP00000013998	0.586	Snail family zinc finger 3
18	9940.ENSOARP00000018384	0.586	Sprouty RTK signaling antagonist 2
19	9940.ENSOARP00000016707	0.581	Acts as a tumor suppressor in many tumor types
20	9940.ENSOARP00000011369	0.580	Nipped-B homolog (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0000987	0.983	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.944	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.936	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.890	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.743	identical protein binding
GO:0008134	0.719	transcription factor binding
GO:0140297	0.610	DNA-binding transcription factor binding
GO:0046983	0.562	protein dimerization activity
GO:0001216	0.522	DNA-binding transcription activator activity
GO:0001228	0.503	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043425	0.488	bHLH transcription factor binding
GO:0042803	0.477	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0050794	0.995	regulation of cellular process
GO:0048519	0.988	negative regulation of biological process
GO:0007275	0.986	multicellular organism development
GO:0050896	0.973	response to stimulus
GO:0050793	0.969	regulation of developmental process
GO:0045667	0.962	regulation of osteoblast differentiation
GO:0048523	0.934	negative regulation of cellular process
GO:0009987	0.930	cellular process
GO:0048522	0.928	positive regulation of cellular process
GO:0045668	0.920	negative regulation of osteoblast differentiation
GO:0048731	0.889	system development
GO:0019222	0.880	regulation of metabolic process
GO:0048513	0.866	animal organ development
GO:0060255	0.866	regulation of macromolecule metabolic process
GO:0010468	0.864	regulation of gene expression
GO:0031323	0.863	regulation of cellular metabolic process
GO:0080090	0.861	regulation of primary metabolic process
GO:0051171	0.861	regulation of nitrogen compound metabolic process
GO:0051239	0.823	regulation of multicellular organismal process
GO:0010941	0.806	regulation of cell death
GO:0009653	0.802	anatomical structure morphogenesis
GO:0042221	0.745	response to chemical
GO:0019219	0.740	regulation of nucleobase-containing compound metabolic process
GO:0009719	0.727	response to endogenous stimulus
GO:2001141	0.696	regulation of RNA biosynthetic process
GO:0006355	0.693	regulation of DNA-templated transcription
GO:0051716	0.685	cellular response to stimulus
GO:0009893	0.662	positive regulation of metabolic process
GO:0010604	0.578	positive regulation of macromolecule metabolic process
GO:0051173	0.539	positive regulation of nitrogen compound metabolic process
GO:0009790	0.529	embryo development
GO:0009792	0.522	embryo development ending in birth or egg hatching
GO:0048869	0.515	cellular developmental process
GO:0030154	0.509	cell differentiation
GO:0031325	0.505	positive regulation of cellular metabolic process
GO:0009892	0.493	negative regulation of metabolic process
GO:0010033	0.491	response to organic substance
GO:0043009	0.479	chordate embryonic development
GO:2000026	0.467	regulation of multicellular organismal development
GO:0042127	0.455	regulation of cell population proliferation
GO:0010605	0.454	negative regulation of macromolecule metabolic process
GO:1901700	0.427	response to oxygen-containing compound
GO:0009891	0.417	positive regulation of biosynthetic process
GO:0006357	0.409	regulation of transcription by RNA polymerase II
GO:0043067	0.406	regulation of programmed cell death
GO:0051172	0.402	negative regulation of nitrogen compound metabolic process
GO:0045935	0.395	positive regulation of nucleobase-containing compound metabolic process
GO:0031324	0.383	negative regulation of cellular metabolic process
GO:0009888	0.371	tissue development
GO:0045893	0.367	positive regulation of DNA-templated transcription
GO:0009887	0.362	animal organ morphogenesis
GO:0048646	0.359	anatomical structure formation involved in morphogenesis
GO:0048583	0.337	regulation of response to stimulus
GO:0072359	0.318	circulatory system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.914	intracellular non-membrane-bounded organelle
GO:0005737	0.803	cytoplasm
GO:0005730	0.341	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]