StarFunc result for job id Q8WVM0

User Input

>input (346 residues)
MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVY
EVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKA
FSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEV
AERLAANTGSKQRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQ
PFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHF
KSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WVM0	1.000	1.000	4.512E-69	346	1.000	1.000	Q8WVM0.pdb.gz	TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1
2	AFDB:Q8JZM0	0.968	0.971	1.347E-61	345	0.841	0.843	Q8JZM0.pdb.gz	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
3	PDB:6ajkA	0.837	0.988	3.705E-53	293	0.844	0.997	6ajkA.pdb.gz	Structural insights into dimethylation of 12S rRNA by TFB1M: indispensable role in translation of mitochondrial genes and mitochondrial function.
4	PDB:4gc5A	0.863	0.935	7.213E-53	319	0.803	0.871	4gc5A.pdb.gz
5	AFDB:Q9VTM5	0.859	0.900	8.501E-38	330	0.451	0.473	Q9VTM5.pdb.gz	TFB1M_DROME Dimethyladenosine transferase 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtTFB1 PE=2 SV=2
6	AFDB:Q54M56	0.817	0.588	9.561E-34	485	0.373	0.266	Q54M56.pdb.gz	Q54M56_DICDI rRNA adenine N(6)-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286199 PE=3 SV=1
7	AFDB:Q38BN0	0.776	0.583	3.485E-23	467	0.240	0.178	Q38BN0.pdb.gz	Q38BN0_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3680 PE=3 SV=1
8	AFDB:P06992	0.674	0.842	1.655E-20	273	0.234	0.297	P06992.pdb.gz	RSMA_ECOLI Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12) OX=83333 GN=rsmA PE=1 SV=1
9	AFDB:Q9USU2	0.674	0.756	2.728E-20	307	0.211	0.238	Q9USU2.pdb.gz	DIM1_SCHPO Dimethyladenosine transferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=3 SV=1
10	AFDB:O65090	0.669	0.674	8.754E-20	343	0.182	0.184	O65090.pdb.gz	DIM1C_ARATH Ribosomal RNA small subunit methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PFC1 PE=2 SV=1
11	AFDB:Q9UNQ2	0.681	0.750	9.253E-20	313	0.225	0.249	Q9UNQ2.pdb.gz	DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
12	AFDB:Q9H5Q4	0.659	0.583	2.128E-19	396	0.182	0.159	Q9H5Q4.pdb.gz	TFB2M_HUMAN Dimethyladenosine transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TFB2M PE=1 SV=1
13	PDB:3tpzB	0.663	0.845	2.654E-19	267	0.225	0.292	3tpzB.pdb.gz
14	PDB:7mqaNL	0.629	0.771	4.262E-18	278	0.214	0.266	7mqaNL.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7ajuJL	0.639	0.772	2.322E-16	283	0.202	0.247	7ajuJL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6erpF	0.601	0.710	1.372E-15	288	0.165	0.198	6erpF.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
17	PDB:6ymwB	0.695	0.706	6.866E-15	340	0.159	0.162	6ymwB.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
18	PDB:6h2vA	0.433	0.687	6.045E-8	210	0.078	0.129	6h2vA.pdb.gz	The human 18S rRNA m6A methyltransferase METTL5 is stabilized by TRMT112.
19	PDB:4lg1A	0.316	0.468	1.281E-6	217	0.084	0.134	4lg1A.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
20	PDB:3v97B	0.338	0.199	4.857E-6	641	0.113	0.061	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8JZM0	0.0	612	345	0.844	0.846	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
2	Q8WVM0	0.0	713	346	1.000	1.000	TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1
3	Q9VTM5	7.76e-97	292	330	0.457	0.479	TFB1M_DROME Dimethyladenosine transferase 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtTFB1 PE=2 SV=2
4	Q54M56	4.45e-71	231	485	0.350	0.249	Q54M56_DICDI rRNA adenine N(6)-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286199 PE=3 SV=1
5	P06992	4.89e-29	115	273	0.249	0.315	RSMA_ECOLI Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12) OX=83333 GN=rsmA PE=1 SV=1
6	Q9FK02	1.36e-18	88.2	380	0.185	0.168	DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIM1B PE=1 SV=1
7	O22268	4.08e-18	86.3	353	0.182	0.178	DIM1A_ARATH Ribosomal RNA small subunit methyltransferase OS=Arabidopsis thaliana OX=3702 GN=DIM1A PE=1 SV=1
8	Q585P9	5.65e-16	80.1	344	0.202	0.203	Q585P9_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.360 PE=3 SV=1
9	O65090	3.68e-14	74.7	343	0.197	0.198	DIM1C_ARATH Ribosomal RNA small subunit methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PFC1 PE=2 SV=1
10	A0A0C4DGB1	6.23e-14	73.2	275	0.173	0.218	A0A0C4DGB1_HUMAN rRNA adenine N(6)-methyltransferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
11	Q9UNQ2	1.05e-13	73.2	313	0.173	0.192	DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
12	Q9USU2	1.70e-12	69.3	307	0.176	0.199	DIM1_SCHPO Dimethyladenosine transferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=3 SV=1
13	Q38BN0	8.55e-11	65.1	467	0.110	0.081	Q38BN0_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3680 PE=3 SV=1
14	P41819	1.46e-10	63.9	318	0.182	0.198	DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIM1 PE=1 SV=1
15	Q3TL26	9.16e-09	58.5	396	0.142	0.124	TFB2M_MOUSE Dimethyladenosine transferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Tfb2m PE=2 SV=1
16	Q9H5Q4	2.40e-08	57.4	396	0.127	0.111	TFB2M_HUMAN Dimethyladenosine transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TFB2M PE=1 SV=1
17	Q9US51	8.66e-05	46.2	366	0.145	0.137	MTF1_SCHPO Mitochondrial transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtf1 PE=3 SV=1
18	Q9VH38	0.018	39.3	452	0.113	0.086	TFB2M_DROME Dimethyladenosine transferase 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtTFB2 PE=2 SV=2
19	P14908	0.078	37.0	341	0.055	0.056	MTF1_YEAST Mitochondrial transcription factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTF1 PE=1 SV=4
20	P54861	2.6	32.3	757	0.090	0.041	DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DNM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00398 RrnaAD	6.2e-39	145.2	Ribosomal RNA adenine dimethylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000465759	0.988	DNA-directed RNA polymerase, mitochondrial
2	9606.ENSP00000220429	0.975	GA-binding protein subunit beta-1
3	9606.ENSP00000376924	0.963	Nuclear respiratory factor 1
4	9606.ENSP00000264867	0.960	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
5	9606.ENSP00000420588	0.956	Transcription factor A, mitochondrial
6	9606.ENSP00000278070	0.953	Peroxisome proliferator-activated receptor gamma coactivator-related protein 1
7	9606.ENSP00000346886	0.953	GA-binding protein alpha chain
8	9606.ENSP00000309555	0.913	Host cell factor 1
9	9606.ENSP00000351644	0.853	tRNA modification GTPase GTPBP3, mitochondrial
10	9606.ENSP00000287025	0.795	Transcription termination factor 3, mitochondrial
11	9606.ENSP00000230340	0.779	Bystin
12	9606.ENSP00000419740	0.779	5-methylcytosine rRNA methyltransferase NSUN4
13	9606.ENSP00000301364	0.767	Pre-rRNA-processing protein TSR1 homolog
14	9606.ENSP00000248643	0.761	Transcription termination factor 1, mitochondrial
15	9606.ENSP00000283109	0.753	Serine/threonine-protein kinase RIO2
16	9606.ENSP00000358812	0.741	Protein RRP5 homolog
17	9606.ENSP00000254928	0.733	GTPase Era, mitochondrial
18	9606.ENSP00000480378	0.706	Transcription termination factor 4, mitochondrial
19	9606.ENSP00000419665	0.703	Single-stranded DNA-binding protein, mitochondrial
20	9606.ENSP00000306080	0.693	rRNA methyltransferase 3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0000179	1.000	rRNA (adenine-N6,N6-)-dimethyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0016070	0.992	RNA metabolic process
GO:0010467	0.982	gene expression
GO:0016072	0.940	rRNA metabolic process
GO:0034470	0.939	ncRNA processing
GO:0042254	0.926	ribosome biogenesis
GO:0009451	0.912	RNA modification
GO:0006364	0.911	rRNA processing
GO:0000154	0.736	rRNA modification
GO:0065007	0.517	biological regulation
GO:0050789	0.449	regulation of biological process
GO:0050794	0.414	regulation of cellular process
GO:0019222	0.332	regulation of metabolic process
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005759	0.787	mitochondrial matrix
GO:0031981	0.729	nuclear lumen
GO:0009295	0.420	nucleoid
GO:0042645	0.408	mitochondrial nucleoid
GO:0005654	0.397	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]