StarFunc result for job id Q8WVM7

User Input

>input (1258 residues)
MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
EAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVKSFLAVCQQCL
SNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID
QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDY
GDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFA
LTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKK
TVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKG
RPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEH
GSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLMEEDAEPIFED
VMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WVM7	1.000	1.000	0.000	1258	1.000	1.000	Q8WVM7.pdb.gz	STAG1_HUMAN Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=3
2	AFDB:Q9DGN1	0.902	0.897	0.000	1265	0.898	0.893	Q9DGN1.pdb.gz	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
3	AFDB:Q9DGN0	0.789	0.831	4.358E-94	1194	0.671	0.707	Q9DGN0.pdb.gz	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
4	PDB:6wg3D	0.705	0.940	3.023E-80	932	0.739	0.998	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
5	PDB:6qnxA	0.727	0.983	3.465E-78	928	0.589	0.798	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
6	AFDB:D6W5U7	0.763	0.782	1.930E-74	1226	0.470	0.482	D6W5U7.pdb.gz	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
7	AFDB:Q99M76	0.759	0.760	2.786E-73	1256	0.455	0.455	Q99M76.pdb.gz	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
8	AFDB:Q9VM62	0.709	0.788	1.036E-62	1127	0.387	0.432	Q9VM62.pdb.gz	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
9	AFDB:Q19555	0.714	0.815	5.674E-52	1096	0.281	0.323	Q19555.pdb.gz	SCC3_CAEEL Cohesin subunit scc-3 OS=Caenorhabditis elegans OX=6239 GN=scc-3 PE=1 SV=1
10	AFDB:O82265	0.625	0.707	3.940E-37	1098	0.203	0.232	O82265.pdb.gz	SCC3_ARATH Sister-chromatid cohesion protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCC3 PE=1 SV=2
11	PDB:6h8qA	0.504	0.695	3.729E-12	879	0.126	0.180	6h8qA.pdb.gz	Structural basis for Scc3-dependent cohesin recruitment to chromatin.
12	PDB:4jlqA	0.208	0.284	9.038E-7	840	0.101	0.151	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
13	AFDB:Q5UIP0	0.187	0.109	9.225E-7	2472	0.109	0.055	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
14	PDB:6xu2A	0.207	0.232	1.642E-6	1091	0.096	0.111	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
15	PDB:4a0cA	0.186	0.197	1.701E-6	1155	0.100	0.109	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
16	PDB:6tc0C	0.175	0.207	2.253E-6	994	0.095	0.120	6tc0C.pdb.gz
17	PDB:5oqrA	0.219	0.325	2.880E-6	751	0.089	0.149	5oqrA.pdb.gz
18	AFDB:Q96UP3	0.156	0.145	6.367E-6	1400	0.123	0.111	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
19	PDB:3w3uA	0.184	0.212	6.931E-6	1030	0.088	0.108	3w3uA.pdb.gz
20	PDB:7unkA	0.207	0.240	8.557E-6	1047	0.106	0.127	7unkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6W5U7	0.0	1141	1226	0.466	0.478	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1
2	O18415	0.0	926	1116	0.396	0.446	O18415_DROME Nuclear protein SA OS=Drosophila melanogaster OX=7227 GN=SA1 PE=2 SV=1
3	O35638	0.0	1783	1231	0.692	0.707	STAG2_MOUSE Cohesin subunit SA-2 OS=Mus musculus OX=10090 GN=Stag2 PE=1 SV=3
4	O70576	0.0	1103	1240	0.444	0.451	STAG3_MOUSE Cohesin subunit SA-3 OS=Mus musculus OX=10090 GN=Stag3 PE=1 SV=2
5	Q19555	0.0	617	1096	0.285	0.327	SCC3_CAEEL Cohesin subunit scc-3 OS=Caenorhabditis elegans OX=6239 GN=scc-3 PE=1 SV=1
6	Q68DW7	0.0	2056	998	0.793	1.000	Q68DW7_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
7	Q8N3U4	0.0	1782	1231	0.692	0.707	STAG2_HUMAN Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3
8	Q8WVM7	0.0	2621	1258	1.000	1.000	STAG1_HUMAN Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=3
9	Q99M76	0.0	1091	1256	0.447	0.447	STAG3_RAT Cohesin subunit SA-3 OS=Rattus norvegicus OX=10116 GN=Stag3 PE=2 SV=1
10	Q9D3E6	0.0	2607	1258	0.994	0.994	STAG1_MOUSE Cohesin subunit SA-1 OS=Mus musculus OX=10090 GN=Stag1 PE=1 SV=3
11	Q9DGN0	0.0	1738	1194	0.680	0.717	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
12	Q9DGN1	0.0	2309	1265	0.900	0.895	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
13	Q9UJ98	0.0	1140	1225	0.465	0.478	STAG3_HUMAN Cohesin subunit SA-3 OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=2
14	Q9VM62	0.0	927	1127	0.397	0.443	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
15	C9JJQ0	4.15e-160	479	232	0.180	0.978	C9JJQ0_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
16	O82265	8.71e-79	285	1098	0.206	0.236	SCC3_ARATH Sister-chromatid cohesion protein 3 OS=Arabidopsis thaliana OX=3702 GN=SCC3 PE=1 SV=2
17	F8WCB3	1.19e-62	212	161	0.079	0.621	F8WCB3_HUMAN Stromal antigen 1 OS=Homo sapiens OX=9606 GN=STAG1 PE=1 SV=1
18	Q9W0F4	3.26e-55	211	973	0.186	0.240	Q9W0F4_DROME Stromalin-2 OS=Drosophila melanogaster OX=7227 GN=SA2 PE=3 SV=3
19	Q3S4X5	1.41e-54	209	973	0.185	0.239	Q3S4X5_DROME SNM OS=Drosophila melanogaster OX=7227 GN=SA2 PE=2 SV=1
20	O13816	3.83e-37	154	962	0.080	0.105	SCC3_SCHPO Cohesin subunit psc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psc3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	13	17.2	non-SMC mitotic condensation complex subunit 1
2	PF12719 Cnd3	1e+02	13.5	Nuclear condensing complex subunits, C-term domain
3	PF14621 RFX5_DNA_bdg	22	16.3	RFX5 DNA-binding domain
4	PF08514 STAG	9.8e-34	127.0	STAG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004932

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005872	0.999	RAD21 cohesin complex component
2	61853.ENSNLEP00000018841	0.999	Structural maintenance of chromosomes 3
3	61853.ENSNLEP00000019395	0.999	Structural maintenance of chromosomes 1A
4	61853.ENSNLEP00000018374	0.994	Stromal antigen 2
5	61853.ENSNLEP00000016150	0.992	Structural maintenance of chromosomes 1B
6	61853.ENSNLEP00000001334	0.970	PDS5 cohesin associated factor B
7	61853.ENSNLEP00000002828	0.970	WAPL cohesin release factor
8	61853.ENSNLEP00000020806	0.960	PDS5 cohesin associated factor A
9	61853.ENSNLEP00000019584	0.959	Nipped-B homolog (Drosophila)
10	61853.ENSNLEP00000021495	0.949	Extra spindle pole bodies homolog 1 (S. cerevisiae)
11	61853.ENSNLEP00000011435	0.945	RAD21-like 1 (S. pombe)
12	61853.ENSNLEP00000018598	0.932	REC8 meiotic recombination protein
13	61853.ENSNLEP00000008427	0.895	Shugoshin-like 2 (S. pombe)
14	61853.ENSNLEP00000006620	0.884	Cell division cycle associated 5
15	61853.ENSNLEP00000002108	0.879	Structural maintenance of chromosomes 6
16	61853.ENSNLEP00000000948	0.874	Uncharacterized protein
17	61853.ENSNLEP00000023958	0.874	Uncharacterized protein
18	61853.ENSNLEP00000014184	0.866	Stromal antigen 3
19	61853.ENSNLEP00000005527	0.855	Structural maintenance of chromosomes 4
20	61853.ENSNLEP00000020060	0.855	Establishment of sister chromatid cohesion N-acetyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.497	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0022402	0.989	cell cycle process
GO:0051276	0.988	chromosome organization
GO:0048285	0.987	organelle fission
GO:0098813	0.984	nuclear chromosome segregation
GO:0000280	0.957	nuclear division
GO:0007052	0.926	mitotic spindle organization
GO:0090307	0.896	mitotic spindle assembly
GO:0050789	0.380	regulation of biological process
GO:0050794	0.370	regulation of cellular process
GO:0051179	0.300	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0000785	0.997	chromatin
GO:0032991	0.972	protein-containing complex
GO:0005829	0.818	cytosol
GO:0044815	0.714	DNA packaging complex
GO:0098687	0.688	chromosomal region
GO:0008278	0.545	cohesin complex
GO:0005819	0.302	spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]