StarFunc result for job id Q8WVS4

User Input

>input (1066 residues)
MEPGKRRTKDDTWKADDLRKHLWAIQSGGSKEERKHREKKLRKESEMDLPEHKEPRCRDP
DQDARSRDRVAEVHTAKESPRGERDRDRQRERRRDAKDREKEKLKEKHREAEKSHSRGKD
REKEKDRRARKEELRQTVAHHNLLGQETRDRQLLERAERKGRSVSKVRSEEKDEDSERGD
EDRERRYRERKLQYGDSKDNPLKYWLYKEEGERRHRKPREPDRDNKHREKSSTREKREKY
SKEKSNSFSDKGEERHKEKRHKEGFHFDDERHQSNVDRKEKSAKDEPRKRESQNGEHRNR
GASSKRDGTSSQHAENLVRNHGKDKDSRRKHGHEEGSSVWWKLDQRPGGEETVEIEKEET
DLENARADAYTASCEDDFEDYEDDFEVCDGDDDESSNEPESREKLEELPLAQKKEIQEIQ
RAINAENERIGELSLKLFQKRGRTEFEKEPRTDTNSSPSRASVCGIFVDFASASHRQKSR
TQALKQKMRSTKLLRLIDLDFSFTFSLLDLPPVNEYDMYIRNFGKKNTKQAYVQCNEDNV
ERDIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMA
VLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSV
HDLPEKSFVPLLDSKYVLCVWDIWQPSGPQKVLICESQVTCCCLSPLKAFLLFAGTAHGS
VVVWDLREDSRLHYSVTLSDGFWTFRTATFSTDGILTSVNHRSPLQAVEPISTSVHKKQS
FVLSPFSTQEEMSGLSFHIASLDESGVLNVWVVVELPKADIAGSISDLGLMPGGRVKLVH
SALIQLGDSLSHKGNEFWGTTQTLNVKFLPSDPNHFIIGTDMGLISHGTRQDLRVAPKLF
KPQQHGIRPVKVNVIDFSPFGEPIFLAGCSDGSIRLHQLSSAFPLLQWDSSTDSHAVTGL
QWSPTRPAVFLVQDDTSNIYIWDLLQSDLGPVAKQQVSPNRLVAMAAVGEPEKAGGSFLA
LVLARASGSIDIQHLKRRWAAPEVDECNRLRLLLQEALWPEGKLHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK66	0.516	0.516	0.000	1066	1.000	1.000	A0A140VK66.pdb.gz	A0A140VK66_HUMAN Testicular secretory protein Li 66 OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:6rlbC	0.396	0.798	1.264E-65	494	0.449	0.970	6rlbC.pdb.gz
3	PDB:7kzmD	0.299	0.646	1.017E-21	456	0.080	0.186	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
4	PDB:6rlbD	0.277	0.616	6.440E-20	446	0.093	0.222	6rlbD.pdb.gz
5	PDB:6f1tp	0.275	0.673	9.876E-18	401	0.083	0.219	6f1tp.pdb.gz	Cryo-EM shows how dynactin recruits two dyneins for faster movement.
6	PDB:7kzmE	0.275	0.573	6.474E-17	474	0.075	0.169	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
7	PDB:3w15A	0.255	0.737	4.577E-15	336	0.032	0.101	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
8	PDB:7mq8LU	0.244	0.548	1.049E-14	445	0.062	0.148	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7jvrB	0.245	0.701	2.276E-14	342	0.060	0.187	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
10	PDB:7vggA	0.234	0.749	6.509E-14	304	0.049	0.171	7vggA.pdb.gz
11	PDB:5yzgW	0.240	0.542	6.879E-14	440	0.058	0.141	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome
12	AFDB:Q9H2Y7	0.225	0.134	5.160E-12	1883	0.093	0.053	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
13	AFDB:O88466	0.233	0.135	6.703E-10	1888	0.105	0.059	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
14	AFDB:Q5JSH3	0.239	0.276	9.341E-10	913	0.109	0.127	Q5JSH3.pdb.gz	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
15	AFDB:P83510	0.230	0.189	1.165E-9	1323	0.123	0.099	P83510.pdb.gz	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2
16	AFDB:M9PBJ7	0.221	0.197	6.840E-9	1213	0.100	0.088	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
17	AFDB:A0A0G2K7W4	0.236	0.191	8.239E-8	1348	0.127	0.100	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
18	AFDB:Q9W002	0.166	0.123	2.110E-7	1504	0.131	0.093	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
19	AFDB:Q9C0J8	0.221	0.178	1.899E-4	1336	0.055	0.044	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
20	AFDB:M9PB01	0.201	0.102	1.938E-3	2397	0.051	0.023	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK66	0.0	2189	1066	1.000	1.000	A0A140VK66_HUMAN Testicular secretory protein Li 66 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q8C761	0.0	1471	999	0.701	0.748	DC2I1_MOUSE Cytoplasmic dynein 2 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2i1 PE=1 SV=1
3	Q8WVS4	0.0	2189	1066	1.000	1.000	DC2I1_HUMAN Cytoplasmic dynein 2 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC2I1 PE=1 SV=3
4	A7MD87	1.69e-13	76.6	501	0.087	0.186	A7MD87_DANRE WD repeat domain 34 OS=Danio rerio OX=7955 GN=dync2i1 PE=1 SV=1
5	Q24246	3.80e-13	76.3	663	0.091	0.146	DYIN_DROME Cytoplasmic dynein 1 intermediate chain OS=Drosophila melanogaster OX=7227 GN=sw PE=1 SV=3
6	O88487	3.16e-11	69.7	612	0.074	0.129	DC1I2_MOUSE Cytoplasmic dynein 1 intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1i2 PE=1 SV=1
7	Q13409	1.18e-10	68.2	638	0.074	0.124	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
8	Q62871	4.09e-09	63.2	638	0.073	0.122	DC1I2_RAT Cytoplasmic dynein 1 intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1i2 PE=1 SV=1
9	E7F6H7	5.79e-09	62.4	626	0.076	0.129	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2
10	Q5XPS1	2.53e-06	54.3	1057	0.029	0.029	Q5XPS1_CHLRE Axonemal inner arm I1 intermediate chain dynein IC138 OS=Chlamydomonas reinhardtii OX=3055 GN=BOP5 PE=1 SV=1
11	Q96EX3	3.34e-06	53.5	536	0.077	0.153	DC2I2_HUMAN Cytoplasmic dynein 2 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC2I2 PE=1 SV=2
12	O45087	5.03e-06	53.1	643	0.066	0.109	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
13	P54703	1.07e-05	52.0	654	0.038	0.061	DYIN_DICDI Cytoplasmic dynein 1 intermediate chain OS=Dictyostelium discoideum OX=44689 GN=dicA PE=2 SV=2
14	Q4QR00	1.40e-05	51.6	587	0.069	0.126	DNAI2_XENLA Dynein axonemal intermediate chain 2 OS=Xenopus laevis OX=8355 GN=dnai2 PE=1 SV=1
15	Q6GPB9	1.40e-05	51.6	742	0.036	0.051	DNAI4_XENLA Dynein axonemal intermediate chain 4 OS=Xenopus laevis OX=8355 GN=dnai4 PE=2 SV=1
16	Q580S1	8.92e-05	48.9	534	0.028	0.056	Q580S1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.770 PE=4 SV=1
17	Q5U4F6	1.11e-04	48.5	537	0.038	0.076	DC2I2_MOUSE Cytoplasmic dynein 2 intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync2i2 PE=1 SV=3
18	A8J3B6	1.82e-04	48.1	1024	0.025	0.026	A8J3B6_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_16g674515v5 PE=1 SV=1
19	Q6PGZ3	0.020	41.2	629	0.023	0.040	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
20	A0A0G2KIZ8	0.082	39.3	968	0.046	0.051	DNAI3_DANRE Dynein axonemal intermediate chain 3 OS=Danio rerio OX=7955 GN=dnai3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00400 WD40	2.1	20.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384290

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000474032	0.998	Cytoplasmic dynein 2 light intermediate chain 1
2	9606.ENSP00000349679	0.996	Dynein light chain roadblock-type 1
3	9606.ENSP00000361800	0.996	WD repeat-containing protein 34
4	9606.ENSP00000376297	0.996	Dynein light chain 1, cytoplasmic
5	9606.ENSP00000381167	0.990	Cytoplasmic dynein 2 heavy chain 1
6	9606.ENSP00000324323	0.965	Tctex1 domain-containing protein 2
7	9606.ENSP00000356056	0.949	Dynein light chain Tctex-type 1
8	9606.ENSP00000367841	0.946	Dynein light chain Tctex-type 3
9	9606.ENSP00000302936	0.938	Dynein light chain roadblock-type 2
10	9606.ENSP00000382717	0.907	WD repeat-containing protein 19
11	9606.ENSP00000477310	0.899	Dynein light chain 2, cytoplasmic
12	9606.ENSP00000406012	0.894	Intraflagellar transport protein 140 homolog
13	9606.ENSP00000243344	0.892	Tetratricopeptide repeat protein 21B
14	9606.ENSP00000312778	0.887	Intraflagellar transport protein 80 homolog
15	9606.ENSP00000260570	0.886	Intraflagellar transport protein 172 homolog
16	9606.ENSP00000314444	0.881	WD repeat-containing protein 35
17	9606.ENSP00000348965	0.843	Cytoplasmic dynein 1 heavy chain 1
18	9606.ENSP00000238628	0.839	Intraflagellar transport proteins
19	9606.ENSP00000347626	0.837	NudC domain containing 3
20	9606.ENSP00000362121	0.836	Intraflagellar transport protein 52 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045503	0.921	dynein light chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120031	0.996	plasma membrane bounded cell projection assembly
GO:0051179	0.995	localization
GO:0060271	0.993	cilium assembly
GO:0042073	0.989	intraciliary transport
GO:0032501	0.967	multicellular organismal process
GO:0007275	0.964	multicellular organism development
GO:0048598	0.941	embryonic morphogenesis
GO:0048513	0.897	animal organ development
GO:0048568	0.876	embryonic organ development
GO:0048731	0.874	system development
GO:0048562	0.868	embryonic organ morphogenesis
GO:0001501	0.843	skeletal system development
GO:0043009	0.707	chordate embryonic development
GO:0048706	0.610	embryonic skeletal system development
GO:0050789	0.497	regulation of biological process
GO:0050794	0.490	regulation of cellular process
GO:0048704	0.348	embryonic skeletal system morphogenesis
GO:0035721	0.309	intraciliary retrograde transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.999	centrosome
GO:0032991	0.987	protein-containing complex
GO:0043227	0.981	membrane-bounded organelle
GO:0097542	0.958	ciliary tip
GO:0005875	0.951	microtubule associated complex
GO:0030286	0.840	dynein complex
GO:0005868	0.814	cytoplasmic dynein complex
GO:0005737	0.757	cytoplasm
GO:0005819	0.409	spindle
GO:0043231	0.396	intracellular membrane-bounded organelle
GO:0005576	0.386	extracellular region
GO:0097546	0.373	ciliary base
GO:0005634	0.345	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]