StarFunc result for job id Q8WVV9

User Input

>input (542 residues)
MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSF
SQPEAGGSHHKVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFEN
IDSAKECVTFAADEPVYIAGQQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPI
TVDVLYTVCNPVGKVQRIVIFKRNGIQAMVEFESVLCAQKAKAALNGADIYAGCCTLKIE
YARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPL
PSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYG
NIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFEL
EDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVL
TFIKYKVFDAKPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSS
HL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q921F4	0.475	0.438	2.950E-99	591	0.965	0.885	Q921F4.pdb.gz	HNRLL_MOUSE Heterogeneous nuclear ribonucleoprotein L-like OS=Mus musculus OX=10090 GN=Hnrnpll PE=1 SV=3
2	AFDB:P14866	0.392	0.361	1.574E-71	589	0.552	0.508	P14866.pdb.gz	HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2
3	AFDB:F1LQ48	0.401	0.350	2.228E-69	623	0.542	0.472	F1LQ48.pdb.gz	HNRPL_RAT Heterogeneous nuclear ribonucleoprotein L OS=Rattus norvegicus OX=10116 GN=Hnrnpl PE=1 SV=2
4	AFDB:A0A0B4K852	0.416	0.452	3.047E-44	497	0.330	0.360	A0A0B4K852.pdb.gz	A0A0B4K852_DROME Smooth, isoform M OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
5	AFDB:P26599	0.342	0.349	3.234E-44	531	0.260	0.266	P26599.pdb.gz	PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=2
6	AFDB:Q7JMZ7	0.414	0.468	9.467E-44	475	0.319	0.364	Q7JMZ7.pdb.gz	Q7JMZ7_DROME Smooth protein OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
7	AFDB:Q66H20	0.339	0.346	1.354E-43	531	0.273	0.279	Q66H20.pdb.gz	PTBP2_RAT Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1
8	AFDB:Q503D3	0.348	0.330	4.741E-43	574	0.271	0.256	Q503D3.pdb.gz	Q503D3_DANRE Polypyrimidine tract-binding protein 1 OS=Danio rerio OX=7955 GN=ptbp1 PE=1 SV=1
9	AFDB:A0A0B4K8A1	0.407	0.426	6.019E-43	515	0.330	0.348	A0A0B4K8A1.pdb.gz	A0A0B4K8A1_DROME Smooth, isoform U OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
10	AFDB:A0A0B4K6P4	0.423	0.307	1.232E-42	799	0.256	0.174	A0A0B4K6P4.pdb.gz	A0A0B4K6P4_DROME Hephaestus, isoform W OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
11	PDB:5vsuA	0.169	0.222	1.637E-13	387	0.107	0.150	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:6r5kH	0.139	0.183	2.840E-10	394	0.140	0.193	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	PDB:6ff7X	0.136	0.405	2.712E-7	171	0.055	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:7oqcF	0.122	0.238	4.926E-7	267	0.055	0.112	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:6y53o	0.124	0.395	5.892E-7	160	0.061	0.206	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7evoD	0.138	0.348	7.480E-7	200	0.068	0.185	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.136	0.391	2.950E-6	178	0.061	0.185	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:5lsbA	0.133	0.374	4.756E-6	176	0.059	0.182	5lsbA.pdb.gz
19	PDB:7dvqY	0.142	0.518	4.873E-5	140	0.028	0.107	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:3lqvB	0.132	0.573	1.344E-4	115	0.028	0.130	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LQ48	0.0	538	623	0.526	0.457	HNRPL_RAT Heterogeneous nuclear ribonucleoprotein L OS=Rattus norvegicus OX=10116 GN=Hnrnpl PE=1 SV=2
2	M0QXS5	0.0	550	530	0.530	0.542	M0QXS5_HUMAN Heterogeneous nuclear ribonucleoprotein L (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=1
3	P14866	0.0	553	589	0.530	0.487	HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2
4	Q8R081	0.0	552	586	0.526	0.486	HNRPL_MOUSE Heterogeneous nuclear ribonucleoprotein L OS=Mus musculus OX=10090 GN=Hnrnpl PE=1 SV=2
5	Q8WVV9	0.0	1133	542	1.000	1.000	HNRLL_HUMAN Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL PE=1 SV=1
6	Q921F4	0.0	991	591	0.871	0.799	HNRLL_MOUSE Heterogeneous nuclear ribonucleoprotein L-like OS=Mus musculus OX=10090 GN=Hnrnpll PE=1 SV=3
7	A0A0B4K7W3	1.54e-90	288	492	0.319	0.352	A0A0B4K7W3_DROME Smooth, isoform L OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
8	A0A0B4K852	1.14e-89	286	497	0.325	0.354	A0A0B4K852_DROME Smooth, isoform M OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
9	A0A0B4K8A1	5.18e-89	285	515	0.327	0.344	A0A0B4K8A1_DROME Smooth, isoform U OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
10	Q6NND8	5.31e-89	284	480	0.315	0.356	Q6NND8_DROME RE74969p OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
11	Q7JMZ7	1.13e-88	283	475	0.323	0.368	Q7JMZ7_DROME Smooth protein OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
12	A0A0B4K8A2	3.42e-88	283	508	0.321	0.343	A0A0B4K8A2_DROME Smooth, isoform AA OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
13	A0A0B4K7I6	4.02e-88	282	491	0.317	0.350	A0A0B4K7I6_DROME Smooth, isoform Z OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
14	A0A0B4K7B0	4.51e-87	279	494	0.315	0.346	A0A0B4K7B0_DROME Smooth, isoform O OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
15	A0A0B4KF04	1.49e-86	278	509	0.315	0.336	A0A0B4KF04_DROME Smooth, isoform AB OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
16	A0A0C4DHD5	4.83e-79	256	434	0.277	0.346	A0A0C4DHD5_DROME Smooth, isoform P OS=Drosophila melanogaster OX=7227 GN=sm PE=1 SV=1
17	Q6ICX4	5.96e-61	209	432	0.260	0.326	PTBP3_ARATH Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana OX=3702 GN=At1g43190 PE=2 SV=1
18	Q66H20	2.67e-47	174	531	0.266	0.271	PTBP2_RAT Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1
19	Q91Z31	2.67e-47	174	531	0.266	0.271	PTBP2_MOUSE Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2
20	Q9UKA9	3.34e-47	174	531	0.266	0.271	PTBP2_HUMAN Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15023 DUF4523	6.1e+02	11.6	Protein of unknown function (DUF4523)
2	PF00076 RRM_1	1.1e-18	78.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF08777 RRM_3	9.1	17.7	RNA binding motif
4	PF13893 RRM_5	3.4e-45	164.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF11835 RRM_8	6e-09	47.3	RRM-like domain
6	PF16842 RRM_occluded	0.068	24.4	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390625

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288207	0.840	G2/mitotic-specific cyclin-B2
2	9606.ENSP00000244020	0.757	Serine/arginine-rich splicing factor 6
3	9606.ENSP00000365439	0.745	Heterogeneous nuclear ribonucleoprotein K
4	9606.ENSP00000256442	0.710	G2/mitotic-specific cyclin-B1
5	9606.ENSP00000300413	0.710	Small nuclear ribonucleoprotein Sm D1
6	9606.ENSP00000379475	0.697	Spliceosome RNA helicase DDX39B
7	9606.ENSP00000260372	0.690	HAUS augmin-like complex subunit 2
8	9606.ENSP00000376276	0.687	Serine/arginine-rich splicing factor 2
9	9606.ENSP00000355890	0.685	Bifunctional glutamate/proline--tRNA ligase
10	9606.ENSP00000309262	0.663	Ubiquitin carboxyl-terminal hydrolase 48
11	9606.ENSP00000355094	0.655	Protein quaking
12	9606.ENSP00000258962	0.633	Serine/arginine-rich splicing factor 1
13	9606.ENSP00000353770	0.625	Ribonucleoside-diphosphate reductase subunit M2
14	9606.ENSP00000242776	0.615	ATP-dependent RNA helicase DDX39A
15	9606.ENSP00000451291	0.608	Heterogeneous nuclear ribonucleoproteins C1/C2
16	9606.ENSP00000370119	0.585	Survival motor neuron protein
17	9606.ENSP00000411355	0.571	Receptor-type tyrosine-protein phosphatase C
18	9606.ENSP00000341826	0.560	Heterogeneous nuclear ribonucleoprotein A1
19	9606.ENSP00000370083	0.560	Survival of motor neuron 1, telomeric
20	9606.ENSP00000305556	0.557	Poly(rC)-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding
GO:0003730	0.699	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043484	0.996	regulation of RNA splicing
GO:0009987	0.925	cellular process
GO:0048518	0.873	positive regulation of biological process
GO:0071704	0.734	organic substance metabolic process
GO:0044237	0.691	cellular metabolic process
GO:0043170	0.676	macromolecule metabolic process
GO:0044238	0.675	primary metabolic process
GO:0048522	0.669	positive regulation of cellular process
GO:0009893	0.669	positive regulation of metabolic process
GO:0006807	0.664	nitrogen compound metabolic process
GO:0046483	0.603	heterocycle metabolic process
GO:0006139	0.588	nucleobase-containing compound metabolic process
GO:0010604	0.586	positive regulation of macromolecule metabolic process
GO:0090304	0.565	nucleic acid metabolic process
GO:0016070	0.563	RNA metabolic process
GO:0010467	0.448	gene expression
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0051173	0.421	positive regulation of nitrogen compound metabolic process
GO:0010628	0.397	positive regulation of gene expression
GO:0006396	0.387	RNA processing
GO:1903311	0.349	regulation of mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0016020	0.979	membrane
GO:0005634	0.965	nucleus
GO:0005654	0.944	nucleoplasm
GO:0005737	0.717	cytoplasm
GO:0005829	0.448	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]