StarFunc result for job id Q8WVY7

User Input

>input (318 residues)
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVK
LGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISR
RVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIV
IWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFS
EFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDF
LDLNHKYWERYLSKKQGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WVY7	1.000	1.000	1.177E-67	318	1.000	1.000	Q8WVY7.pdb.gz	UBCP1_HUMAN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2
2	AFDB:Q556S4	0.586	0.474	1.218E-32	399	0.399	0.318	Q556S4.pdb.gz	Q556S4_DICDI protein-serine/threonine phosphatase OS=Dictyostelium discoideum OX=44689 GN=ublcp1-2 PE=4 SV=1
3	AFDB:Q9XYL0	0.412	0.426	7.539E-10	306	0.142	0.147	Q9XYL0.pdb.gz	CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum OX=44689 GN=fcpA PE=3 SV=1
4	AFDB:O94336	0.441	0.566	8.002E-10	244	0.154	0.201	O94336.pdb.gz	YHM3_SCHPO Uncharacterized FCP1 homology domain-containing protein C1271.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.03c PE=4 SV=1
5	AFDB:O14595	0.426	0.490	6.421E-9	271	0.123	0.144	O14595.pdb.gz	CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2
6	AFDB:P38757	0.416	0.304	1.568E-8	446	0.138	0.099	P38757.pdb.gz	NEM1_YEAST Nuclear envelope morphology protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEM1 PE=1 SV=1
7	AFDB:Q6NWD4	0.430	0.359	1.568E-8	387	0.129	0.106	Q6NWD4.pdb.gz	TIM50_DANRE Mitochondrial import inner membrane translocase subunit TIM50 OS=Danio rerio OX=7955 GN=timm50 PE=2 SV=2
8	AFDB:O15194	0.411	0.467	1.766E-8	276	0.113	0.130	O15194.pdb.gz	CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens OX=9606 GN=CTDSPL PE=1 SV=2
9	AFDB:Q59W44	0.424	0.299	1.874E-8	469	0.123	0.083	Q59W44.pdb.gz	TIM50_CANAL Mitochondrial import inner membrane translocase subunit TIM50 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM50 PE=3 SV=1
10	AFDB:Q6P3I6	0.414	0.502	1.989E-8	258	0.119	0.147	Q6P3I6.pdb.gz	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
11	PDB:7rbsB	0.194	0.371	6.838E-5	157	0.075	0.153	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
12	PDB:6yvaC	0.194	0.373	8.676E-5	155	0.060	0.123	6yvaC.pdb.gz
13	PDB:4pyuA	0.213	0.818	9.772E-5	76	0.047	0.197	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
14	PDB:3plvA	0.211	0.763	1.168E-4	80	0.044	0.175	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
15	PDB:6mdhA	0.213	0.437	3.027E-4	149	0.047	0.101	6mdhA.pdb.gz
16	PDB:3ai5A	0.205	0.218	5.171E-4	299	0.047	0.050	3ai5A.pdb.gz
17	PDB:3tixA	0.208	0.410	8.833E-4	153	0.044	0.092	3tixA.pdb.gz
18	PDB:3dbhI	0.211	0.715	9.950E-4	86	0.047	0.174	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
19	PDB:7w3ax	0.187	0.127	1.121E-3	494	0.113	0.073	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
20	PDB:5xqmA	0.201	0.623	1.700E-3	90	0.041	0.144	5xqmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WVY7	0.0	649	318	1.000	1.000	UBCP1_HUMAN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens OX=9606 GN=UBLCP1 PE=1 SV=2
2	Q556S4	5.55e-67	216	399	0.421	0.336	Q556S4_DICDI protein-serine/threonine phosphatase OS=Dictyostelium discoideum OX=44689 GN=ublcp1-2 PE=4 SV=1
3	Q92353	2.17e-09	60.5	468	0.104	0.071	UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp6 PE=1 SV=2
4	Q38EV9	5.25e-08	55.8	343	0.148	0.137	Q38EV9_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4480 PE=4 SV=1
5	O94336	7.95e-07	51.6	244	0.138	0.180	YHM3_SCHPO Uncharacterized FCP1 homology domain-containing protein C1271.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.03c PE=4 SV=1
6	Q38EW0	8.35e-07	52.4	343	0.142	0.131	Q38EW0_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4460 PE=4 SV=1
7	Q583H3	1.95e-04	45.1	465	0.085	0.058	Q583H3_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.180 PE=3 SV=1
8	Q9JMA1	5.41e-04	43.9	493	0.082	0.053	UBP14_MOUSE Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus OX=10090 GN=Usp14 PE=1 SV=3
9	Q0IIF7	5.92e-04	43.9	494	0.082	0.053	UBP14_BOVIN Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus OX=9913 GN=USP14 PE=2 SV=3
10	P54578	0.001	43.1	494	0.082	0.053	UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3
11	P43593	0.007	40.4	499	0.101	0.064	UBP6_YEAST Ubiquitin carboxyl-terminal hydrolase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP6 PE=1 SV=1
12	Q949Y0	0.008	40.0	482	0.075	0.050	UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=UBP6 PE=1 SV=1
13	Q9VKZ8	0.028	38.5	475	0.085	0.057	Q9VKZ8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp14 PE=1 SV=1
14	Q38DA6	0.042	37.4	283	0.072	0.081	Q38DA6_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4020 PE=4 SV=1
15	A6NJA2	0.29	35.0	448	0.066	0.047	A6NJA2_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=2
16	Q6P3I6	0.56	33.9	258	0.123	0.151	Q6P3I6_DANRE protein-serine/threonine phosphatase OS=Danio rerio OX=7955 GN=zgc:77714 PE=2 SV=1
17	Q8BX07	0.72	33.5	270	0.091	0.107	CTDS2_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus OX=10090 GN=Ctdsp2 PE=2 SV=1
18	Q385R7	1.3	33.1	369	0.097	0.084	Q385R7_TRYB2 FCP1 homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2650 PE=4 SV=1
19	Q9LNC5	1.5	33.1	987	0.119	0.039	CLO_ARATH 110 kDa U5 small nuclear ribonucleoprotein component CLO OS=Arabidopsis thaliana OX=3702 GN=CLO PE=1 SV=1
20	F4JWP9	1.6	33.1	973	0.119	0.039	GFL_ARATH 109 kDa U5 small nuclear ribonucleoprotein component GFL OS=Arabidopsis thaliana OX=3702 GN=GFL PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05152 DUF705	5.7	17.9	Protein of unknown function (DUF705)
2	PF03031 NIF	3.8e-27	106.4	NLI interacting factor-like phosphatase
3	PF00240 ubiquitin	0.00016	32.7	Ubiquitin family
4	PF14560 Ubiquitin_2	1.2e+02	14.5	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008585896.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008575230.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 32 mRNAs, 21 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008580238.1	0.990	26S proteasome non-ATPase regulatory subunit 3
3	482537.XP_008564686.1	0.989	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008561839.1	0.988	26S protease regulatory subunit 4
5	482537.XP_008580502.1	0.988	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 22 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
6	482537.XP_008565164.1	0.986	26S protease regulatory subunit 10B
7	482537.XP_008590465.1	0.985	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 36 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008562210.1	0.984	26S proteasome non-ATPase regulatory subunit 6
9	482537.XP_008582491.1	0.984	26S proteasome non-ATPase regulatory subunit 4 isoform X1
10	482537.XP_008572757.1	0.981	Proteasome subunit alpha type-4
11	482537.XP_008577301.1	0.980	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 33 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	482537.XP_008572173.1	0.979	26S proteasome non-ATPase regulatory subunit 8
13	482537.XP_008566117.1	0.978	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 18 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008585987.1	0.973	26S proteasome non-ATPase regulatory subunit 1
15	482537.XP_008569320.1	0.972	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
16	482537.XP_008584801.1	0.970	26S proteasome non-ATPase regulatory subunit 13
17	482537.XP_008572098.1	0.961	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	482537.XP_008564715.1	0.959	Proteasome subunit alpha type-5
19	482537.XP_008583880.1	0.959	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
20	482537.XP_008579048.1	0.955	Proteasome subunit beta type-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0016311	0.994	dephosphorylation
GO:0036211	0.992	protein modification process
GO:0006470	0.983	protein dephosphorylation
GO:0065007	0.355	biological regulation
GO:0050789	0.348	regulation of biological process
GO:0050794	0.322	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.979	nucleolus
GO:0005829	0.970	cytosol
GO:0032991	0.936	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]