StarFunc result for job id Q8WW27

User Input

>input (367 residues)
MEPIYEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTF
PQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
YSNNSPCNEANHCCISKMYNFLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASL
WPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHNAYEINAITGVKPYFT
DVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDLRAPVVFVLVPLRD
LPPMHMGQNPNKPRNIVRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEK
KKKKGKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WW27	1.000	1.000	4.962E-78	367	1.000	1.000	Q8WW27.pdb.gz	ABEC4_HUMAN Putative C->U-editing enzyme APOBEC-4 OS=Homo sapiens OX=9606 GN=APOBEC4 PE=1 SV=1
2	PDB:6x91H	0.405	0.273	1.857E-9	558	0.109	0.072	6x91H.pdb.gz	The structure of APOBEC1 and insights into its RNA and DNA substrate selectivity.
3	PDB:6x91A	0.412	0.263	2.590E-8	592	0.114	0.071	6x91A.pdb.gz	The structure of APOBEC1 and insights into its RNA and DNA substrate selectivity.
4	PDB:3vm8A	0.406	0.760	2.757E-8	187	0.079	0.155	3vm8A.pdb.gz	Crystal structure of the human APOBEC3C having HIV-1 Vif-binding interface
5	PDB:6b0bA	0.390	0.744	8.531E-8	180	0.084	0.172	6b0bA.pdb.gz	The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism.
6	PDB:7d3vB	0.373	0.640	3.994E-5	199	0.095	0.176	7d3vB.pdb.gz	Non-specific and specific interactions work cooperatively to promote cytidine deamination catalyzed by APOBEC3
7	PDB:2w4lE	0.203	0.382	8.809E-3	162	0.065	0.148	2w4lE.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
8	PDB:1z3aA	0.153	0.310	5.104E-2	156	0.035	0.083	1z3aA.pdb.gz	Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase.
9	PDB:2fr6A	0.144	0.318	5.786E-2	137	0.046	0.124	2fr6A.pdb.gz	The 1.48 A Resolution Crystal Structure of the Homotetrameric Cytidine Deaminase from Mouse
10	PDB:1mq0A	0.151	0.347	8.978E-2	130	0.049	0.138	1mq0A.pdb.gz	Structure of human cytidine deaminase bound to a potent inhibitor
11	PDB:5dmnA	0.085	0.108	1.084E-1	263	0.035	0.049	5dmnA.pdb.gz
12	AFDB:F4IGZ2	0.151	0.068	2.233E-1	910	0.071	0.029	F4IGZ2.pdb.gz	SMXL8_ARATH Protein SMAX1-LIKE 8 OS=Arabidopsis thaliana OX=3702 GN=SMXL8 PE=1 SV=1
13	AFDB:Q381M0	0.088	0.066	3.464E-1	519	0.104	0.073	Q381M0.pdb.gz	Q381M0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7310 PE=4 SV=1
14	AFDB:Q96RN1	0.089	0.040	6.093E-1	970	0.071	0.027	Q96RN1.pdb.gz	S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens OX=9606 GN=SLC26A8 PE=1 SV=1
15	AFDB:O07257	0.090	0.072	2.137	511	0.090	0.065	O07257.pdb.gz	O07257_MYCTU Adhesion protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2059 PE=4 SV=3
16	AFDB:C7J2Z1	0.077	0.099	2.423	269	0.052	0.071	C7J2Z1.pdb.gz	ABI4_ORYSJ Ethylene-responsive transcription factor ABI4 OS=Oryza sativa subsp. japonica OX=39947 GN=ABI4 PE=3 SV=1
17	AFDB:P38817	0.076	0.055	2.580	585	0.071	0.044	P38817.pdb.gz	GGA2_YEAST ADP-ribosylation factor-binding protein GGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GGA2 PE=1 SV=1
18	AFDB:B3DHL9	0.073	0.043	2.925	959	0.131	0.050	B3DHL9.pdb.gz
19	AFDB:P32744	0.090	0.043	3.114	1020	0.076	0.027	P32744.pdb.gz	CLAS2_CAEEL Protein CLASP-2 OS=Caenorhabditis elegans OX=6239 GN=cls-2 PE=1 SV=3
20	AFDB:Q6P0D0	0.087	0.093	4.262	341	0.074	0.079	Q6P0D0.pdb.gz	QKIA_DANRE Protein quaking-A OS=Danio rerio OX=7955 GN=qkia PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WW27	0.0	769	367	1.000	1.000	ABEC4_HUMAN Putative C->U-editing enzyme APOBEC-4 OS=Homo sapiens OX=9606 GN=APOBEC4 PE=1 SV=1
2	P38483	0.061	37.0	229	0.065	0.105	ABEC1_RAT C->U-editing enzyme APOBEC-1 OS=Rattus norvegicus OX=10116 GN=Apobec1 PE=1 SV=1
3	P51908	0.98	33.5	229	0.060	0.096	ABEC1_MOUSE C->U-editing enzyme APOBEC-1 OS=Mus musculus OX=10090 GN=Apobec1 PE=1 SV=1
4	Q9HC16	1.1	33.5	384	0.071	0.068	ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G OS=Homo sapiens OX=9606 GN=APOBEC3G PE=1 SV=1
5	P41238	1.4	33.1	236	0.057	0.089	ABEC1_HUMAN C->U-editing enzyme APOBEC-1 OS=Homo sapiens OX=9606 GN=APOBEC1 PE=1 SV=3
6	Q8IUX4	2.3	32.7	373	0.049	0.048	ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F OS=Homo sapiens OX=9606 GN=APOBEC3F PE=1 SV=3
7	Q8RXR2	3.0	32.3	781	0.035	0.017	CLCF_ARATH Chloride channel protein CLC-f OS=Arabidopsis thaliana OX=3702 GN=CLC-F PE=2 SV=2
8	B0QYD3	3.1	32.3	490	0.049	0.037	B0QYD3_HUMAN Apolipoprotein B mRNA editing enzyme catalytic subunit 3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
9	Q9UH17	3.9	32.0	382	0.049	0.047	ABC3B_HUMAN DNA dC->dU-editing enzyme APOBEC-3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
10	Q7YR24	4.4	31.6	384	0.068	0.065	ABC3G_PANTR DNA dC->dU-editing enzyme APOBEC-3G OS=Pan troglodytes OX=9598 GN=APOBEC3G PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18769 APOBEC1	0.39	22.3	APOBEC1
2	PF18772 APOBEC2	0.0068	27.9	APOBEC2
3	PF18771 APOBEC3	3.2	19.4	APOBEC3
4	PF18775 APOBEC4	2.9e-18	77.1	APOBEC4
5	PF18774 APOBEC4_like	0.33	22.3	APOBEC4-like -AID/APOBEC-deaminase
6	PF08210 APOBEC_N	1.3e-28	111.6	APOBEC-like N-terminal domain
7	PF14428 DddA-like	1.4e+02	13.8	Double-stranded DNA deaminase toxin A
8	PF18778 NAD1	2.1e-26	104.6	Novel AID APOBEC clade 1
9	PF18782 NAD2	0.71	21.5	Novel AID APOBEC clade 2
10	PF18750 SNAD4	1.6e-14	65.4	Secreted Novel AID/APOBEC-like Deaminase 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310622

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244669	0.990	C->U-editing enzyme APOBEC-2
2	9606.ENSP00000229304	0.988	C->U-editing enzyme APOBEC-1
3	9606.ENSP00000384359	0.982	DNA dC->dU-editing enzyme APOBEC-3A
4	9606.ENSP00000355340	0.979	DNA dC->dU-editing enzyme APOBEC-3C
5	9606.ENSP00000385741	0.979	DNA dC->dU-editing enzyme APOBEC-3H
6	9606.ENSP00000327459	0.977	DNA dC->dU-editing enzyme APOBEC-3B
7	9606.ENSP00000216099	0.834	DNA dC->dU-editing enzyme APOBEC-3D
8	9606.ENSP00000309749	0.834	DNA dC->dU-editing enzyme APOBEC-3F
9	9606.ENSP00000385057	0.811	DNA dC->dU-editing enzyme APOBEC-3G
10	9606.ENSP00000378868	0.771	APOBEC1 complementation factor
11	9606.ENSP00000364212	0.764	Cytidine deaminase
12	9606.ENSP00000229335	0.732	Single-stranded DNA cytosine deaminase
13	9606.ENSP00000233242	0.713	Apolipoprotein B-100
14	9606.ENSP00000384490	0.661	Chromobox protein homolog 6
15	9606.ENSP00000419740	0.623	5-methylcytosine rRNA methyltransferase NSUN4
16	9606.ENSP00000465500	0.565	Tumor necrosis factor receptor superfamily member 11A
17	9606.ENSP00000376808	0.552	Cullin-5
18	9606.ENSP00000237283	0.514	tRNA-specific adenosine deaminase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.851	catalytic activity
GO:0016787	0.570	hydrolase activity
GO:0019239	0.416	deaminase activity
GO:0016814	0.415	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0050789	0.993	regulation of biological process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043412	0.987	macromolecule modification
GO:0050794	0.984	regulation of cellular process
GO:0009451	0.976	RNA modification
GO:0048519	0.907	negative regulation of biological process
GO:0019222	0.876	regulation of metabolic process
GO:0050896	0.771	response to stimulus
GO:0060255	0.763	regulation of macromolecule metabolic process
GO:0051171	0.763	regulation of nitrogen compound metabolic process
GO:0080090	0.762	regulation of primary metabolic process
GO:0048523	0.755	negative regulation of cellular process
GO:0031323	0.753	regulation of cellular metabolic process
GO:0019219	0.692	regulation of nucleobase-containing compound metabolic process
GO:0006259	0.638	DNA metabolic process
GO:0051252	0.586	regulation of RNA metabolic process
GO:0006304	0.582	DNA modification
GO:0016553	0.559	base conversion or substitution editing
GO:0006950	0.456	response to stress
GO:0031324	0.449	negative regulation of cellular metabolic process
GO:0010605	0.417	negative regulation of macromolecule metabolic process
GO:0045934	0.405	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.379	negative regulation of RNA metabolic process
GO:0009605	0.323	response to external stimulus
GO:0044419	0.317	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.966	intracellular organelle lumen
GO:0032991	0.839	protein-containing complex
GO:0031981	0.800	nuclear lumen
GO:0005654	0.793	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.570	Hydrolases.
EC:3.5.4.-	0.415	In cyclic amidines.

[back to server]