StarFunc result for job id Q8WW33

User Input

>input (167 residues)
MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVP
RAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFV
WGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WW33	1.000	1.000	5.403E-31	167	1.000	1.000	Q8WW33.pdb.gz	GTSF1_HUMAN Gametocyte-specific factor 1 OS=Homo sapiens OX=9606 GN=GTSF1 PE=1 SV=2
2	AFDB:Q9H1H1	0.419	0.472	3.241E-8	148	0.240	0.270	Q9H1H1.pdb.gz	GTSFL_HUMAN Gametocyte-specific factor 1-like OS=Homo sapiens OX=9606 GN=GTSF1L PE=1 SV=1
3	AFDB:Q8SWX0	0.362	0.362	2.492E-5	167	0.210	0.210	Q8SWX0.pdb.gz	ASTRX_DROME Gametocyte-specific factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=arx PE=1 SV=1
4	AFDB:Q9N360	0.251	0.075	4.154E-2	662	0.156	0.039	Q9N360.pdb.gz	Q9N360_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=znf-782 PE=1 SV=1
5	AFDB:D6XEI2	0.152	0.078	9.610E-2	330	0.192	0.097	D6XEI2.pdb.gz	D6XEI2_TRYB2 TRAF-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.250 PE=4 SV=1
6	AFDB:Q9VHJ3	0.184	0.066	1.832E-1	588	0.132	0.037	Q9VHJ3.pdb.gz	Q9VHJ3_DROME Enhancer of variegation 3-9 OS=Drosophila melanogaster OX=7227 GN=E(var)3-9 PE=1 SV=1
7	AFDB:Q14CW9	0.151	0.085	2.084E-1	347	0.126	0.061	Q14CW9.pdb.gz	AT7L3_HUMAN Ataxin-7-like protein 3 OS=Homo sapiens OX=9606 GN=ATXN7L3 PE=1 SV=1
8	AFDB:Q15527	0.147	0.101	5.485E-1	256	0.132	0.086	Q15527.pdb.gz	SURF2_HUMAN Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=4
9	AFDB:Q8N448	0.225	0.062	5.485E-1	690	0.132	0.032	Q8N448.pdb.gz	LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens OX=9606 GN=LNX2 PE=1 SV=1
10	AFDB:F1R1J1	0.191	0.057	6.241E-1	705	0.144	0.034	F1R1J1.pdb.gz
11	PDB:7pntX	0.153	0.084	7.007E-1	357	0.066	0.031	7pntX.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
12	PDB:7ktrE	0.129	0.170	3.090	124	0.096	0.129	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
13	PDB:6hivBM	0.144	0.106	3.515	245	0.126	0.086	6hivBM.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:5vxcA	0.124	0.083	3.999	301	0.042	0.023	5vxcA.pdb.gz	The Human Knockout Gene CLYBL Connects Itaconate to Vitamin B12.
15	PDB:6slmA	0.144	0.060	3.999	539	0.048	0.015	6slmA.pdb.gz	Structure of High-Risk Papillomavirus 31 E6 Oncogenic Protein and Characterization of E6/E6AP/p53 Complex Formation.
16	PDB:7nacm	0.133	0.038	4.853	666	0.138	0.035	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
17	PDB:2mxxA	0.139	0.132	5.177	179	0.102	0.095	2mxxA.pdb.gz
18	PDB:6akjB	0.102	0.133	5.177	110	0.090	0.136	6akjB.pdb.gz
19	PDB:7l08AX	0.137	0.078	5.177	353	0.084	0.040	7l08AX.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:6ijaD	0.153	0.073	6.701	389	0.024	0.010	6ijaD.pdb.gz	Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-beta-l-rhamnose and rhamnosylation mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WW33	1.46e-125	351	167	1.000	1.000	GTSF1_HUMAN Gametocyte-specific factor 1 OS=Homo sapiens OX=9606 GN=GTSF1 PE=1 SV=2
2	Q9DAN6	1.15e-115	326	167	0.916	0.916	GTSF1_MOUSE Gametocyte-specific factor 1 OS=Mus musculus OX=10090 GN=Gtsf1 PE=1 SV=1
3	Q9H1H1	1.33e-14	68.9	148	0.186	0.209	GTSFL_HUMAN Gametocyte-specific factor 1-like OS=Homo sapiens OX=9606 GN=GTSF1L PE=1 SV=1
4	Q8SWX0	2.63e-09	55.5	167	0.198	0.198	ASTRX_DROME Gametocyte-specific factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=arx PE=1 SV=1
5	Q9VMU7	2.31e-08	51.2	93	0.156	0.280	Q9VMU7_DROME FI16614p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG14036 PE=2 SV=1
6	A3QMD6	3.41e-04	41.2	169	0.126	0.124	A3QMD6_CAEEL CHHC U11-48K-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtsf-1 PE=4 SV=1
7	Q57YB8	0.003	39.3	429	0.162	0.063	Q57YB8_TRYB2 RRM domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.240 PE=4 SV=1
8	Q55FG3	0.76	32.3	3848	0.108	0.005	VP13C_DICDI Intermembrane lipid transfer protein tipC OS=Dictyostelium discoideum OX=44689 GN=tipC PE=3 SV=1
9	Q38FR6	3.6	30.4	8214	0.066	0.001	Q38FR6_TRYB2 Mitotubule-associated protein Gb4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1200 PE=4 SV=1
10	O88990	4.1	30.0	900	0.120	0.022	ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus OX=10090 GN=Actn3 PE=2 SV=1
11	P36159	8.4	29.3	838	0.108	0.021	RNZ_YEAST Ribonuclease Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRZ1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05253 zf-U11-48K	4.5e-17	72.8	U11-48K-like CHHC zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005571145.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005542587.1	0.907	Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis.
2	9541.XP_005540176.1	0.875	Tudor domain-containing protein 5 isoform X1
3	9541.XP_005588803.1	0.875	Tudor domain-containing protein 12 isoform X1
4	9541.XP_005550654.1	0.871	Uncharacterized protein
5	9541.XP_005562382.1	0.866	Uncharacterized protein
6	9541.XP_005549412.1	0.854	Peptidyl-prolyl cis-trans isomerase FKBP6 isoform X1
7	9541.XP_005539921.1	0.827	Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with piP-bodies suggests a participation in the secondary piRNAs metabolic process. Required for the localization of germ-cell factors to the meiotic nuage (By similarity).
8	9541.XP_005583063.1	0.823	Phospholipase D family member 6
9	9541.XP_005566544.1	0.795	Tudor domain-containing protein 1
10	9541.XP_005566999.1	0.794	Mov10 RISC complex RNA helicase like 1
11	9541.XP_005541911.1	0.776	Tudor and KH domain-containing protein isoform X1
12	9541.XP_005562841.1	0.743	Piwi-like protein 2 isoform X1
13	9541.XP_005554921.1	0.704	Zygote arrest protein 1 isoform X1
14	9541.XP_005572682.1	0.703	Piwi-like protein 1 isoform X1
15	9541.XP_005585658.1	0.700	ZAR1-like protein
16	9541.XP_005579444.1	0.696	Belongs to the argonaute family.
17	9541.XP_005559729.1	0.675	Essential for the control of the cell cycle at the G2/M (mitosis) transition
18	9541.XP_005567800.1	0.637	Piwi-like protein 3
19	9541.XP_005562189.1	0.609	Uncharacterized protein
20	9541.XP_005552222.1	0.600	F-box only protein 5 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000049	1.000	tRNA binding
GO:0005515	0.403	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0019222	0.990	regulation of metabolic process
GO:0032501	0.978	multicellular organismal process
GO:0048856	0.977	anatomical structure development
GO:0009987	0.966	cellular process
GO:0010468	0.963	regulation of gene expression
GO:0048519	0.960	negative regulation of biological process
GO:0030154	0.911	cell differentiation
GO:0050794	0.825	regulation of cellular process
GO:0009892	0.800	negative regulation of metabolic process
GO:0010605	0.737	negative regulation of macromolecule metabolic process
GO:0007275	0.712	multicellular organism development
GO:0009889	0.635	regulation of biosynthetic process
GO:0031323	0.629	regulation of cellular metabolic process
GO:0051171	0.620	regulation of nitrogen compound metabolic process
GO:0031326	0.597	regulation of cellular biosynthetic process
GO:0080090	0.591	regulation of primary metabolic process
GO:0010556	0.590	regulation of macromolecule biosynthetic process
GO:0048523	0.505	negative regulation of cellular process
GO:0019953	0.455	sexual reproduction
GO:0032504	0.454	multicellular organism reproduction
GO:0022414	0.453	reproductive process
GO:0010629	0.436	negative regulation of gene expression
GO:0022412	0.430	cellular process involved in reproduction in multicellular organism
GO:0031047	0.417	RNA-mediated gene silencing
GO:0007276	0.415	gamete generation
GO:0003006	0.342	developmental process involved in reproduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.887	organelle
GO:0043229	0.881	intracellular organelle
GO:0043231	0.819	intracellular membrane-bounded organelle
GO:0005634	0.567	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]