StarFunc result for job id Q8WW36

User Input

>input (166 residues)
MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNC
VLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGH
IQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WW36	1.000	1.000	7.702E-34	166	1.000	1.000	Q8WW36.pdb.gz	ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZCCHC13 PE=1 SV=1
2	AFDB:P53996	0.421	0.397	4.256E-17	178	0.596	0.556	P53996.pdb.gz	CNBP_MOUSE CCHC-type zinc finger nucleic acid binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2
3	AFDB:F1Q6Z5	0.411	0.417	2.064E-14	163	0.512	0.521	F1Q6Z5.pdb.gz	F1Q6Z5_DANRE CCHC-type zinc finger, nucleic acid-binding protein a OS=Danio rerio OX=7955 GN=fe36b09 PE=1 SV=1
4	AFDB:E7FCQ0	0.434	0.446	3.062E-14	161	0.506	0.522	E7FCQ0.pdb.gz	E7FCQ0_DANRE CCHC-type zinc finger, nucleic acid-binding protein b OS=Danio rerio OX=7955 GN=cnbp PE=1 SV=2
5	AFDB:P34689	0.224	0.060	4.542E-6	763	0.283	0.062	P34689.pdb.gz	GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans OX=6239 GN=glh-1 PE=1 SV=3
6	AFDB:Q966L9	0.214	0.046	9.365E-6	974	0.313	0.053	Q966L9.pdb.gz	GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans OX=6239 GN=glh-2 PE=1 SV=1
7	AFDB:Q65XV7	0.255	0.066	1.068E-5	951	0.229	0.040	Q65XV7.pdb.gz	RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica OX=39947 GN=RPA1C PE=1 SV=1
8	PDB:7c4cA	0.145	0.102	4.545E-5	332	0.169	0.084	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
9	AFDB:Q9P795	0.211	0.140	1.390E-4	315	0.199	0.105	Q9P795.pdb.gz	AIR1_SCHPO Protein air1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=air1 PE=1 SV=2
10	AFDB:Q38896	0.169	0.146	1.218E-1	201	0.211	0.174	Q38896.pdb.gz	CSP4_ARATH Cold shock domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=CSP4 PE=1 SV=1
11	AFDB:O01836	0.158	0.050	1.585E-1	720	0.139	0.032	O01836.pdb.gz	GLH3_CAEEL ATP-dependent RNA helicase glh-3 OS=Caenorhabditis elegans OX=6239 GN=glh-3 PE=1 SV=1
12	PDB:2aqcA	0.083	0.193	1.069	63	0.072	0.190	2aqcA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
13	PDB:7uhyD	0.114	0.081	1.069	288	0.096	0.056	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:6exnc	0.120	0.097	2.867	204	0.060	0.049	6exnc.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
15	PDB:3haxC	0.065	0.199	4.543	53	0.048	0.151	3haxC.pdb.gz	Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
16	PDB:6hlqI	0.070	0.086	4.852	111	0.096	0.144	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
17	PDB:7dvq0	0.139	0.190	5.534	100	0.066	0.110	7dvq0.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:6gejS	0.093	0.077	6.312	208	0.060	0.048	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7d58L	0.073	0.202	7.690	47	0.036	0.128	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
20	PDB:6tapE	0.118	0.540	8.212	27	0.042	0.259	6tapE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WW36	1.89e-118	333	166	1.000	1.000	ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZCCHC13 PE=1 SV=1
2	P62633	4.31e-56	176	177	0.590	0.554	CNBP_HUMAN CCHC-type zinc finger nucleic acid binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1
3	P62634	4.31e-56	176	177	0.590	0.554	CNBP_RAT CCHC-type zinc finger nucleic acid binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1
4	P53996	2.79e-54	171	178	0.590	0.551	CNBP_MOUSE CCHC-type zinc finger nucleic acid binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2
5	E7FCQ0	1.20e-47	154	161	0.488	0.503	E7FCQ0_DANRE CCHC-type zinc finger, nucleic acid-binding protein b OS=Danio rerio OX=7955 GN=cnbp PE=1 SV=2
6	F1Q6Z5	7.08e-47	152	163	0.506	0.515	F1Q6Z5_DANRE CCHC-type zinc finger, nucleic acid-binding protein a OS=Danio rerio OX=7955 GN=fe36b09 PE=1 SV=1
7	P36627	1.46e-22	90.5	179	0.349	0.324	BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr3 PE=4 SV=1
8	P53849	1.23e-20	84.7	153	0.331	0.359	GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIS2 PE=1 SV=1
9	Q59YJ9	4.69e-20	84.0	175	0.289	0.274	Q59YJ9_CANAL mRNA-binding translational activator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIS2 PE=4 SV=1
10	O65639	1.52e-17	79.7	299	0.367	0.204	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
11	O76743	1.31e-14	72.8	1156	0.229	0.033	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
12	Q9GRG8	1.75e-13	65.9	140	0.277	0.329	Q9GRG8_9TRYP CCHC zinc finger protein OS=Trypanosoma brucei OX=5691 GN=ZFP PE=2 SV=1
13	Q8T8R1	5.75e-13	65.1	165	0.235	0.236	CNBP_DROME CCHC-type zinc finger nucleic acid binding protein OS=Drosophila melanogaster OX=7227 GN=CNBP PE=1 SV=1
14	Q38AZ9	7.46e-13	64.3	140	0.241	0.286	Q38AZ9_TRYB2 Universal minicircle sequence binding protein (UMSBP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0800 PE=4 SV=1
15	Q383X8	7.54e-12	64.3	516	0.277	0.089	Q383X8_TRYB2 Nucleic acid binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1270 PE=4 SV=1
16	Q38B00	7.42e-11	60.5	213	0.289	0.225	Q38B00_TRYB2 Universal minicircle sequence binding protein (UMSBP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0820 PE=4 SV=1
17	Q94C69	1.08e-10	60.8	301	0.271	0.150	CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=CSP3 PE=1 SV=1
18	P03348	1.05e-09	58.2	512	0.163	0.053	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
19	P03347	2.50e-09	57.0	512	0.163	0.053	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
20	Q8GXC5	2.66e-09	56.6	257	0.211	0.136	Q8GXC5_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g75560 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	7e-24	94.0	Zinc knuckle
2	PF14392 zf-CCHC_4	5.8e-06	37.1	Zinc knuckle
3	PF14787 zf-CCHC_5	0.25	22.4	GAG-polyprotein viral zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337358	0.768	Haloacid dehalogenase-like hydrolase domain-containing 5
2	9606.ENSP00000362601	0.631	Cysteine-rich hydrophobic domain-containing protein 1
3	9606.ENSP00000414597	0.589	EF-hand and coiled-coil domain containing 1
4	9606.ENSP00000425421	0.568	Spermidine/spermine N1-acetyl transferase like 1
5	9606.ENSP00000328059	0.567	E3 ubiquitin-protein ligase RLIM
6	9606.ENSP00000364320	0.564	mRNA turnover protein 4 homolog
7	9606.ENSP00000351395	0.551	Secretoglobin family 1D member 4
8	9606.ENSP00000298283	0.545	60S ribosomal protein L10-like
9	9606.ENSP00000413436	0.545	60S ribosomal protein L10
10	9606.ENSP00000297873	0.542	Methyltransferase-like protein 27
11	9606.ENSP00000375730	0.542	60S ribosomal protein L13a
12	9606.ENSP00000362616	0.534	Nucleosome assembly protein 1-like 2
13	9606.ENSP00000392511	0.520	Proline rich transmembrane protein 3
14	9606.ENSP00000465734	0.517	Monocarboxylate transporter 8
15	9606.ENSP00000273541	0.510	Pre-mRNA-splicing factor ISY1 homolog
16	9606.ENSP00000411822	0.508	Component of the spliceosome C complex required for the selective processing of microRNAs during embryonic stem cell differentiation (By similarity). Required for the biogenesis of all miRNAs from the pri-miR-17-92 primary transcript except miR-92a (By similarity). Only required for the biogenesis of miR-290 and miR-96 from the pri-miR-290-295 and pri-miR-96-183 primary transcripts, respectively (By similarity). Required during the transition of embryonic stem cells (ESCs) from the naive to primed state (By similarity). By enhancing miRNA biogenesis, promotes exit of ESCs from the naiv [...]
17	9606.ENSP00000328307	0.502	Protein FAM47B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.946	RNA binding
GO:0003824	0.310	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0019222	0.982	regulation of metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0080090	0.909	regulation of primary metabolic process
GO:0010468	0.905	regulation of gene expression
GO:0009889	0.881	regulation of biosynthetic process
GO:0019219	0.847	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.841	regulation of cellular biosynthetic process
GO:0010556	0.840	regulation of macromolecule biosynthetic process
GO:0051252	0.813	regulation of RNA metabolic process
GO:0048518	0.798	positive regulation of biological process
GO:0048519	0.753	negative regulation of biological process
GO:0032502	0.752	developmental process
GO:0048523	0.687	negative regulation of cellular process
GO:0048522	0.671	positive regulation of cellular process
GO:0010605	0.660	negative regulation of macromolecule metabolic process
GO:0006355	0.638	regulation of DNA-templated transcription
GO:0051172	0.610	negative regulation of nitrogen compound metabolic process
GO:0031324	0.601	negative regulation of cellular metabolic process
GO:0009893	0.581	positive regulation of metabolic process
GO:0031325	0.564	positive regulation of cellular metabolic process
GO:0008152	0.508	metabolic process
GO:0071704	0.427	organic substance metabolic process
GO:0044237	0.416	cellular metabolic process
GO:0006807	0.413	nitrogen compound metabolic process
GO:0044238	0.367	primary metabolic process
GO:0043170	0.330	macromolecule metabolic process
GO:0032501	0.325	multicellular organismal process
GO:0010604	0.319	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.995	intracellular organelle
GO:0005829	0.990	cytosol
GO:0005634	0.988	nucleus
GO:0070013	0.946	intracellular organelle lumen
GO:0031981	0.759	nuclear lumen
GO:0043232	0.435	intracellular non-membrane-bounded organelle
GO:0005783	0.369	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]