StarFunc result for job id Q8WW38

User Input

>input (1151 residues)
MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEV
EYFCNKGDDEGIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQL
PVGTTWGPFPGKMDLNNNSLKTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQ
LWCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLDSIQLLPQQAAMASIL
PTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEENEDSAHQISSLCPF
PQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQ
AAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLA
SSPVQPNIGPSFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIY
SPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTG
QTSINLLNPAAHSADPENPLLQTSCINSSTVLDLIGPNGKGHDKDFSTQTKKLSTSSNND
DKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKR
SASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEGL
GECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPES
ERNSPDVSYERSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRH
LFLPQCLYPGAIKKAKGADQLSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQAS
SNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWIS
ENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKF
YCSSHAAEHVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2GM62	0.189	0.190	0.000	1142	0.633	0.638	B2GM62.pdb.gz
2	AFDB:A0A0R4IQP3	0.278	0.289	5.045E-84	1093	0.444	0.468	A0A0R4IQP3.pdb.gz
3	AFDB:O35615	0.110	0.123	3.744E-47	995	0.315	0.364	O35615.pdb.gz	FOG1_MOUSE Zinc finger protein ZFPM1 OS=Mus musculus OX=10090 GN=Zfpm1 PE=1 SV=1
4	AFDB:A2A935	0.070	0.064	8.801E-11	1275	0.152	0.137	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
5	AFDB:A2A7B5	0.078	0.054	5.726E-9	1709	0.151	0.102	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
6	AFDB:Q9C0A6	0.072	0.059	5.057E-8	1442	0.156	0.124	Q9C0A6.pdb.gz	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
7	AFDB:A0A1W2PQA1	0.064	0.068	2.034E-7	1069	0.138	0.149	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
8	AFDB:O54963	0.066	0.070	3.506E-7	1069	0.131	0.141	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
9	AFDB:Q13029	0.078	0.057	1.042E-6	1718	0.153	0.102	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
10	AFDB:Q9W5E0	0.071	0.065	1.176E-6	1300	0.121	0.107	Q9W5E0.pdb.gz	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
11	PDB:5h6zA	0.074	0.545	1.489E-3	123	0.015	0.138	5h6zA.pdb.gz
12	PDB:2g46A	0.070	0.525	8.104E-3	119	0.013	0.126	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
13	PDB:5wg6A	0.070	0.142	8.078E-2	517	0.022	0.048	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
14	PDB:7td5A	0.065	0.139	1.161E-1	497	0.016	0.036	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:5ex0A	0.043	0.094	1.234E-1	429	0.013	0.035	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
16	PDB:7td5F	0.066	0.154	1.393E-1	447	0.016	0.040	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:7ksoA	0.067	0.175	1.572E-1	395	0.015	0.043	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
18	PDB:3qxyA	0.041	0.102	2.002E-1	420	0.007	0.019	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
19	PDB:1pegA	0.063	0.244	2.127E-1	266	0.014	0.060	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
20	PDB:5hynA	0.068	0.126	2.401E-1	581	0.017	0.034	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GM63	0.0	565	1018	0.304	0.344	B2GM63_DANRE Neural friend of GATA-B OS=Danio rerio OX=7955 GN=FOG-B PE=2 SV=1
2	D4A0R1	0.0	2214	1151	0.944	0.944	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
3	E7ET52	0.0	2123	1019	0.885	1.000	E7ET52_HUMAN Zinc finger protein, FOG family member 2 OS=Homo sapiens OX=9606 GN=ZFPM2 PE=1 SV=1
4	F1R4T3	0.0	1447	1142	0.639	0.644	F1R4T3_DANRE Zinc finger protein ZFPM2 isoform X1 OS=Danio rerio OX=7955 GN=FOG-A PE=4 SV=1
5	Q2QKJ8	0.0	894	1093	0.449	0.473	Q2QKJ8_DANRE Fog2b OS=Danio rerio OX=7955 GN=fog2b PE=2 SV=1
6	Q2QKJ9	0.0	1431	1141	0.634	0.640	Q2QKJ9_DANRE Fog2a OS=Danio rerio OX=7955 GN=fog2a PE=2 SV=1
7	Q8CCH7	0.0	2209	1151	0.939	0.939	FOG2_MOUSE Zinc finger protein ZFPM2 OS=Mus musculus OX=10090 GN=Zfpm2 PE=1 SV=2
8	Q8WW38	0.0	2400	1151	1.000	1.000	FOG2_HUMAN Zinc finger protein ZFPM2 OS=Homo sapiens OX=9606 GN=ZFPM2 PE=1 SV=3
9	O35615	4.36e-114	380	995	0.277	0.321	FOG1_MOUSE Zinc finger protein ZFPM1 OS=Mus musculus OX=10090 GN=Zfpm1 PE=1 SV=1
10	Q8IX07	7.53e-93	322	1006	0.232	0.265	FOG1_HUMAN Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2
11	P60622	2.22e-35	136	224	0.079	0.406	FOG1_DANRE Zinc finger protein ZFPM1 (Fragment) OS=Danio rerio OX=7955 GN=zfpm1 PE=1 SV=1
12	Q9H9D4	5.52e-07	56.2	720	0.046	0.074	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1
13	Q9NX65	2.17e-06	54.3	697	0.032	0.053	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
14	O60304	3.31e-06	53.5	480	0.024	0.058	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
15	Q9VR05	1.05e-05	51.6	346	0.032	0.107	PARIS_DROME Zinc finger protein Paris OS=Drosophila melanogaster OX=7227 GN=Paris PE=1 SV=2
16	P17098	1.19e-05	52.0	575	0.051	0.103	ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2
17	Q9VPQ6	1.99e-05	51.6	1191	0.073	0.071	USH_DROME Zinc finger protein ush OS=Drosophila melanogaster OX=7227 GN=ush PE=1 SV=2
18	Q7TS63	2.02e-05	51.6	1237	0.031	0.029	ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus OX=10090 GN=Zfat PE=1 SV=2
19	Q5VV52	2.03e-05	50.4	315	0.033	0.121	ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens OX=9606 GN=ZNF691 PE=1 SV=2
20	F1QWQ9	2.07e-05	51.2	568	0.058	0.118	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	9.8e-06	36.9	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	0.00017	33.1	C2H2-type zinc finger
3	PF15909 zf-C2H2_8	24	16.7	C2H2-type zinc ribbon
4	PF12171 zf-C2H2_jaz	1.9e-06	39.2	Zinc-finger double-stranded RNA-binding
5	PF12874 zf-met	3.2	19.5	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334458	0.999	Transcription factor GATA-4
2	9606.ENSP00000365858	0.975	Erythroid transcription factor
3	9606.ENSP00000368632	0.924	Trans-acting T-cell-specific transcription factor GATA-3
4	9606.ENSP00000377721	0.912	COUP transcription factor 2
5	9606.ENSP00000345681	0.889	Endothelial transcription factor GATA-2
6	9606.ENSP00000269216	0.879	Transcription factor GATA-6
7	9606.ENSP00000331327	0.850	Wilms tumor protein
8	9606.ENSP00000311825	0.844	C-terminal-binding protein 2
9	9606.ENSP00000362690	0.839	Steroidogenic factor 1
10	9606.ENSP00000428056	0.803	Phosphatidylinositol 3-kinase regulatory subunit alpha
11	9606.ENSP00000252997	0.783	Transcription factor GATA-5
12	9606.ENSP00000309913	0.585	T-box transcription factor TBX5
13	9606.ENSP00000327758	0.581	Homeobox protein Nkx-2.5
14	9606.ENSP00000415283	0.577	Intercellular adhesion molecule 2
15	9606.ENSP00000307369	0.563	SH2 domain-containing adapter protein E
16	9606.ENSP00000358042	0.563	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
17	9606.ENSP00000480297	0.561	Zinc finger protein 2
18	9606.ENSP00000290921	0.550	C-terminal-binding protein 1
19	9606.ENSP00000340874	0.526	Myocyte-specific enhancer factor 2C
20	9606.ENSP00000352565	0.525	Heart- and neural crest derivatives-expressed protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003690	0.444	double-stranded DNA binding
GO:1990837	0.410	sequence-specific double-stranded DNA binding
GO:0140110	0.384	transcription regulator activity
GO:0001067	0.336	transcription regulatory region nucleic acid binding
GO:0000976	0.333	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0045893	0.992	positive regulation of DNA-templated transcription
GO:0007275	0.991	multicellular organism development
GO:0045892	0.991	negative regulation of DNA-templated transcription
GO:0009888	0.986	tissue development
GO:0072359	0.978	circulatory system development
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0007507	0.970	heart development
GO:0009887	0.968	animal organ morphogenesis
GO:0009987	0.952	cellular process
GO:0014706	0.938	striated muscle tissue development
GO:0000122	0.930	negative regulation of transcription by RNA polymerase II
GO:0061061	0.887	muscle structure development
GO:0003007	0.887	heart morphogenesis
GO:0045944	0.887	positive regulation of transcription by RNA polymerase II
GO:0050793	0.842	regulation of developmental process
GO:0048729	0.842	tissue morphogenesis
GO:0045595	0.772	regulation of cell differentiation
GO:0048738	0.760	cardiac muscle tissue development
GO:0007517	0.756	muscle organ development
GO:0055008	0.750	cardiac muscle tissue morphogenesis
GO:0048869	0.535	cellular developmental process
GO:0030154	0.533	cell differentiation
GO:0051239	0.425	regulation of multicellular organismal process
GO:0051093	0.385	negative regulation of developmental process
GO:0045596	0.379	negative regulation of cell differentiation
GO:0003205	0.357	cardiac chamber development
GO:0003206	0.341	cardiac chamber morphogenesis
GO:0003279	0.318	cardiac septum development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.418	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]