StarFunc result for job id Q8WWA0

User Input

>input (313 residues)
MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRT
ENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANY
NTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLG
HNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRV
FNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSS
REITEAAVLLFYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWA0	1.000	1.000	9.925E-75	313	1.000	1.000	Q8WWA0.pdb.gz	ITLN1_HUMAN Intelectin-1 OS=Homo sapiens OX=9606 GN=ITLN1 PE=1 SV=1
2	PDB:4wmqA	0.889	0.983	3.198E-66	283	0.904	1.000	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
3	AFDB:O88310	0.893	0.893	1.995E-65	313	0.812	0.812	O88310.pdb.gz	ITL1A_MOUSE Intelectin-1a OS=Mus musculus OX=10090 GN=Itln1 PE=1 SV=1
4	AFDB:Q5PPM0	0.881	0.813	1.554E-55	339	0.649	0.599	Q5PPM0.pdb.gz	ITLN1_XENLA Intelectin-1 OS=Xenopus laevis OX=8355 GN=itln1 PE=1 SV=1
5	PDB:5zc0A	0.879	0.979	1.806E-53	281	0.617	0.687	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
6	AFDB:A5PLE5	0.882	0.780	5.726E-53	354	0.572	0.506	A5PLE5.pdb.gz	A5PLE5_DANRE LOC100007792 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC100007792 PE=2 SV=1
7	AFDB:P86928	0.845	0.845	4.366E-52	313	0.613	0.613	P86928.pdb.gz	INTLP_ALLMI Intelectin-like protein OS=Alligator mississippiensis OX=8496 PE=1 SV=1
8	AFDB:P0DMV4	0.878	0.846	8.079E-52	325	0.546	0.526	P0DMV4.pdb.gz	ITLN_ONCMY Intelectin OS=Oncorhynchus mykiss OX=8022 GN=itln PE=1 SV=1
9	AFDB:A0A1D5NSF1	0.880	0.815	1.169E-51	338	0.581	0.538	A0A1D5NSF1.pdb.gz
10	AFDB:A0A2R8RJR8	0.804	0.809	1.569E-48	311	0.521	0.524	A0A2R8RJR8.pdb.gz
11	AFDB:C1IHU8	0.858	0.863	8.158E-45	311	0.466	0.469	C1IHU8.pdb.gz
12	AFDB:Q9DFE0	0.307	0.772	1.366E-8	121	0.169	0.438	Q9DFE0.pdb.gz	Q9DFE0_ONCMY Putative intelectin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	PDB:1jc9A	0.242	0.329	5.502E-4	220	0.086	0.123	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
14	PDB:3ghgB	0.235	0.190	7.486E-4	401	0.058	0.045	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.307	0.259	9.004E-4	397	0.109	0.086	1ei3C.pdb.gz
16	PDB:3ghgI	0.326	0.274	1.772E-3	394	0.109	0.086	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
17	PDB:1m1jB	0.238	0.193	2.267E-3	402	0.058	0.045	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
18	PDB:7lxdE	0.072	0.106	1.644	205	0.013	0.020	7lxdE.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
19	PDB:2km7A	0.081	0.168	1.748	102	0.022	0.069	2km7A.pdb.gz
20	PDB:4ubsA	0.059	0.051	2.379	393	0.016	0.013	4ubsA.pdb.gz	Structural basis for the 4'-hydroxylation of diclofenac by a microbial cytochrome P450 monooxygenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88310	0.0	536	313	0.812	0.812	ITL1A_MOUSE Intelectin-1a OS=Mus musculus OX=10090 GN=Itln1 PE=1 SV=1
2	Q80ZA0	0.0	523	313	0.792	0.792	ITL1B_MOUSE Intelectin-1b OS=Mus musculus OX=10090 GN=Itln1b PE=1 SV=1
3	Q8WWA0	0.0	657	313	1.000	1.000	ITLN1_HUMAN Intelectin-1 OS=Homo sapiens OX=9606 GN=ITLN1 PE=1 SV=1
4	Q5PPM0	7.98e-146	415	339	0.617	0.569	ITLN1_XENLA Intelectin-1 OS=Xenopus laevis OX=8355 GN=itln1 PE=1 SV=1
5	P86928	6.77e-137	392	313	0.585	0.585	INTLP_ALLMI Intelectin-like protein OS=Alligator mississippiensis OX=8496 PE=1 SV=1
6	A5PLE5	3.41e-131	379	354	0.546	0.483	A5PLE5_DANRE LOC100007792 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC100007792 PE=2 SV=1
7	C1IHV0	3.86e-131	378	341	0.546	0.501	C1IHV0_DANRE Intelectin 2 OS=Danio rerio OX=7955 GN=INTL2 PE=2 SV=1
8	P0DMV4	6.77e-124	359	325	0.530	0.511	ITLN_ONCMY Intelectin OS=Oncorhynchus mykiss OX=8022 GN=itln PE=1 SV=1
9	A0A2R8QEW4	1.78e-98	294	305	0.441	0.452	A0A2R8QEW4_DANRE Intelectin 1 OS=Danio rerio OX=7955 GN=INTL1 PE=1 SV=1
10	Q08CC6	1.41e-97	292	310	0.441	0.445	Q08CC6_DANRE Intelectin 1 precursor OS=Danio rerio OX=7955 GN=zgc:153267 PE=1 SV=1
11	Q9DFE0	1.09e-30	114	121	0.169	0.438	Q9DFE0_ONCMY Putative intelectin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	Q6NYE1	0.031	38.1	485	0.061	0.039	Q6NYE1_DANRE Fibrinogen beta chain OS=Danio rerio OX=7955 GN=wu:fa55c11 PE=1 SV=1
13	O75636	0.32	34.7	299	0.051	0.054	FCN3_HUMAN Ficolin-3 OS=Homo sapiens OX=9606 GN=FCN3 PE=1 SV=2
14	D6REL8	0.44	34.3	272	0.080	0.092	D6REL8_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=1
15	P02675	0.50	34.7	491	0.080	0.051	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
16	V9HVY1	0.50	34.7	491	0.080	0.051	V9HVY1_HUMAN Epididymis secretory sperm binding protein Li 78p OS=Homo sapiens OX=9606 GN=HEL-S-78p PE=2 SV=1
17	Q9Y5C1	0.59	34.3	460	0.067	0.046	ANGL3_HUMAN Angiopoietin-related protein 3 OS=Homo sapiens OX=9606 GN=ANGPTL3 PE=1 SV=1
18	Q9Y264	0.84	33.9	503	0.054	0.034	ANGP4_HUMAN Angiopoietin-4 OS=Homo sapiens OX=9606 GN=ANGPT4 PE=1 SV=1
19	Q9WVH6	0.93	33.5	509	0.089	0.055	ANGP4_MOUSE Angiopoietin-4 OS=Mus musculus OX=10090 GN=Angpt4 PE=1 SV=1
20	Q9FXB0	0.99	32.7	166	0.077	0.145	Q9FXB0_ARATH At1g56580/F25P12_18 OS=Arabidopsis thaliana OX=3702 GN=SVB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00147 Fibrinogen_C	5.9	18.2	Fibrinogen beta and gamma chains, C-terminal globular domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323587

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357008	0.890	Intelectin-2
2	9606.ENSP00000342109	0.857	Serpin A12
3	9606.ENSP00000418009	0.802	Retinoic acid receptor responder protein 2
4	9606.ENSP00000222553	0.801	Nicotinamide phosphoribosyltransferase
5	9606.ENSP00000221515	0.761	Resistin
6	9606.ENSP00000389814	0.754	Adiponectin
7	9606.ENSP00000391800	0.720	Apelin
8	9606.ENSP00000312652	0.689	Leptin
9	9606.ENSP00000360522	0.687	Retinol-binding protein 4
10	9606.ENSP00000361725	0.674	Endonuclease G, mitochondrial
11	9606.ENSP00000380432	0.604	Insulin
12	9606.ENSP00000346981	0.594	Transmembrane protein 207
13	9606.ENSP00000255030	0.533	C-reactive protein
14	9606.ENSP00000369045	0.530	Serine peptidase inhibitor, Kazal type 4
15	9606.ENSP00000332139	0.517	Complement factor D
16	9606.ENSP00000234701	0.513	Calcium-activated chloride channel regulator 1
17	9606.ENSP00000385675	0.504	Interleukin-6
18	9606.ENSP00000324173	0.503	78 kDa glucose-regulated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070492	1.000	oligosaccharide binding
GO:0005515	0.981	protein binding
GO:0043167	0.924	ion binding
GO:0043169	0.863	cation binding
GO:0046872	0.851	metal ion binding
GO:0005509	0.826	calcium ion binding
GO:0042802	0.701	identical protein binding
GO:0005102	0.357	signaling receptor binding
GO:0097367	0.355	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0051707	0.936	response to other organism
GO:0050794	0.917	regulation of cellular process
GO:0009987	0.916	cellular process
GO:0048518	0.877	positive regulation of biological process
GO:0019222	0.855	regulation of metabolic process
GO:0048522	0.844	positive regulation of cellular process
GO:0060255	0.780	regulation of macromolecule metabolic process
GO:0031323	0.679	regulation of cellular metabolic process
GO:0080090	0.662	regulation of primary metabolic process
GO:0051171	0.660	regulation of nitrogen compound metabolic process
GO:0009624	0.625	response to nematode
GO:0009893	0.600	positive regulation of metabolic process
GO:0010604	0.575	positive regulation of macromolecule metabolic process
GO:0001934	0.487	positive regulation of protein phosphorylation
GO:0032879	0.479	regulation of localization
GO:0051049	0.473	regulation of transport
GO:0006950	0.450	response to stress
GO:0006952	0.387	defense response
GO:0048519	0.386	negative regulation of biological process
GO:0048523	0.378	negative regulation of cellular process
GO:0051050	0.376	positive regulation of transport
GO:0008152	0.350	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.995	extracellular space
GO:0043227	0.966	membrane-bounded organelle
GO:0032991	0.883	protein-containing complex
GO:0005622	0.882	intracellular anatomical structure
GO:0005737	0.870	cytoplasm
GO:0031982	0.862	vesicle
GO:0070062	0.841	extracellular exosome
GO:0071944	0.832	cell periphery
GO:0016020	0.809	membrane
GO:0005886	0.699	plasma membrane
GO:0043231	0.511	intracellular membrane-bounded organelle
GO:0030141	0.474	secretory granule
GO:0070013	0.425	intracellular organelle lumen
GO:0031012	0.367	extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]