StarFunc result for job id Q8WWC4

User Input

>input (291 residues)
MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARA
LAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPIN
WVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALK
EKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETL
RGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWC4	1.000	1.000	1.843E-53	291	1.000	1.000	Q8WWC4.pdb.gz	MAIP1_HUMAN m-AAA protease-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MAIP1 PE=1 SV=1
2	AFDB:Q9W0X3	0.486	0.536	1.057E-12	263	0.206	0.228	Q9W0X3.pdb.gz	Q9W0X3_DROME LD24657p OS=Drosophila melanogaster OX=7227 GN=DmP29 PE=1 SV=1
3	PDB:7o9md	0.348	0.444	3.451E-4	220	0.113	0.150	7o9md.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
4	PDB:7odrd	0.397	0.441	5.892E-4	259	0.113	0.127	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
5	AFDB:O62305	0.191	0.107	1.367E-3	720	0.134	0.054	O62305.pdb.gz	KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=2
6	AFDB:Q55559	0.225	0.109	2.073E-3	714	0.179	0.073	Q55559.pdb.gz	Q55559_SYNY3 Sll0169 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll0169 PE=1 SV=1
7	AFDB:O06311	0.191	0.201	6.412E-3	275	0.113	0.120	O06311.pdb.gz	O06311_MYCTU Probable conserved membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0361 PE=1 SV=1
8	AFDB:Q69IU0	0.111	0.113	1.032E-2	284	0.127	0.130	Q69IU0.pdb.gz	Q69IU0_ORYSJ Transcription factor OS=Oryza sativa subsp. japonica OX=39947 GN=P0498F03.15 PE=3 SV=1
9	PDB:5u6yA	0.208	0.156	2.806E-2	459	0.072	0.046	5u6yA.pdb.gz
10	AFDB:Q54D84	0.097	0.050	2.833E-2	697	0.124	0.052	Q54D84.pdb.gz	TRIA_DICDI Trishanku OS=Dictyostelium discoideum OX=44689 GN=triA PE=2 SV=1
11	PDB:6baqF	0.143	0.187	4.008E-2	211	0.062	0.085	6baqF.pdb.gz
12	AFDB:Q9S7Y1	0.098	0.082	4.295E-2	368	0.124	0.098	Q9S7Y1.pdb.gz	BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis thaliana OX=3702 GN=BHLH30 PE=1 SV=1
13	AFDB:Q6FI91	0.093	0.069	5.782E-2	438	0.110	0.073	Q6FI91.pdb.gz	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
14	AFDB:Q54F20	0.106	0.029	6.910E-2	1575	0.134	0.025	Q54F20.pdb.gz	Q54F20_DICDI Nucleoporin 155 OS=Dictyostelium discoideum OX=44689 GN=nup155 PE=4 SV=1
15	PDB:1qmaA	0.213	0.425	7.707E-2	126	0.055	0.127	1qmaA.pdb.gz
16	PDB:1uliD	0.200	0.267	1.037E-1	178	0.082	0.135	1uliD.pdb.gz	Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
17	PDB:3ff0A	0.138	0.216	1.101E-1	162	0.038	0.068	3ff0A.pdb.gz
18	PDB:4wwuC	0.136	0.211	1.240E-1	165	0.031	0.055	4wwuC.pdb.gz	Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
19	PDB:1eg9B	0.241	0.313	1.396E-1	193	0.086	0.130	1eg9B.pdb.gz	Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
20	PDB:7f5yB	0.078	0.151	1.396E-1	120	0.041	0.100	7f5yB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWC4	0.0	600	291	1.000	1.000	MAIP1_HUMAN m-AAA protease-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MAIP1 PE=1 SV=1
2	Q9W0X3	6.63e-13	69.3	263	0.230	0.255	Q9W0X3_DROME LD24657p OS=Drosophila melanogaster OX=7227 GN=DmP29 PE=1 SV=1
3	A0A0B4LHN1	1.16e-05	47.4	201	0.165	0.239	A0A0B4LHN1_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Jhebp29 PE=1 SV=1
4	Q5SSE9	2.4	32.3	5034	0.069	0.004	ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus OX=10090 GN=Abca13 PE=1 SV=1
5	Q8NFZ0	2.5	32.3	1043	0.100	0.028	FBH1_HUMAN F-box DNA helicase 1 OS=Homo sapiens OX=9606 GN=FBH1 PE=1 SV=2
6	Q10275	3.4	31.6	269	0.072	0.078	YD3B_SCHPO Uncharacterized protein C13G7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC13G7.11 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07961 MBA1	21	15.6	MBA1-like protein
2	PF04280 Tim44	8.1	18.0	Tim44-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295079

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249269	0.930	Mitochondrial-processing peptidase subunit beta
2	9606.ENSP00000360782	0.921	Mitochondrial-processing peptidase subunit alpha
3	9606.ENSP00000268704	0.881	Paraplegin
4	9606.ENSP00000479488	0.854	Prohibitin
5	9606.ENSP00000269143	0.831	AFG3-like protein 2
6	9606.ENSP00000441875	0.803	Prohibitin-2
7	9606.ENSP00000362144	0.786	Calcium uniporter protein, mitochondrial
8	9606.ENSP00000418803	0.710	Complex I assembly factor TIMMDC1, mitochondrial
9	9606.ENSP00000371811	0.677	Calcium uptake protein 2, mitochondrial
10	9606.ENSP00000482786	0.652	Formiminotransferase cyclodeaminase N-terminal like
11	9606.ENSP00000321455	0.650	Calcium uptake protein 3, mitochondrial
12	9606.ENSP00000354415	0.650	Calcium uptake protein 1, mitochondrial
13	9606.ENSP00000378145	0.650	Calcium uniporter regulatory subunit MCUb, mitochondrial
14	9606.ENSP00000312770	0.625	UPF0565 protein C2orf69
15	9606.ENSP00000327467	0.608	Essential MCU regulator, mitochondrial
16	9606.ENSP00000465356	0.591	Apolipoprotein C-I
17	9606.ENSP00000389060	0.559	Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
18	9606.ENSP00000352941	0.543	BTB/POZ domain-containing protein KCTD18
19	9606.ENSP00000468236	0.535	Apolipoprotein C-IV
20	9606.ENSP00000346627	0.520	tRNA wybutosine-synthesizing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007005	0.982	mitochondrion organization
GO:1990542	0.975	mitochondrial transmembrane transport
GO:0070588	0.975	calcium ion transmembrane transport
GO:0006874	0.944	intracellular calcium ion homeostasis
GO:0006839	0.937	mitochondrial transport
GO:0072594	0.934	establishment of protein localization to organelle
GO:0015031	0.927	protein transport
GO:0051560	0.903	mitochondrial calcium ion homeostasis
GO:0072655	0.902	establishment of protein localization to mitochondrion
GO:0006886	0.858	intracellular protein transport
GO:0007006	0.852	mitochondrial membrane organization
GO:0051205	0.810	protein insertion into membrane
GO:0090151	0.804	establishment of protein localization to mitochondrial membrane
GO:0008152	0.682	metabolic process
GO:0051204	0.628	protein insertion into mitochondrial membrane
GO:0071704	0.472	organic substance metabolic process
GO:0044238	0.438	primary metabolic process
GO:0006807	0.385	nitrogen compound metabolic process
GO:0006851	0.358	mitochondrial calcium ion transmembrane transport
GO:0036444	0.347	calcium import into the mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005743	0.999	mitochondrial inner membrane
GO:0005759	0.992	mitochondrial matrix
GO:0032991	0.889	protein-containing complex
GO:0031981	0.421	nuclear lumen
GO:0005654	0.381	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]