StarFunc result for job id Q8WWG9

User Input

>input (221 residues)
MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNS
THPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSL
LLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSES
SSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWG9	0.999	0.999	1.306E-31	221	1.000	1.000	Q8WWG9.pdb.gz	KCNE4_HUMAN Potassium voltage-gated channel subfamily E member 4 OS=Homo sapiens OX=9606 GN=KCNE4 PE=1 SV=4
2	AFDB:Q9DBN4	0.140	0.109	6.193E-1	303	0.136	0.099	Q9DBN4.pdb.gz	P33MX_MOUSE Putative monooxygenase p33MONOX OS=Mus musculus OX=10090 GN=P33monox PE=1 SV=1
3	AFDB:Q96A73	0.126	0.102	7.153E-1	305	0.131	0.095	Q96A73.pdb.gz	P33MX_HUMAN Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1
4	AFDB:Q4G5U1	0.157	0.055	1.273	815	0.190	0.052	Q4G5U1.pdb.gz
5	AFDB:Q8N423	0.130	0.058	1.471	598	0.136	0.050	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	AFDB:Q96RJ3	0.108	0.125	1.471	184	0.140	0.168	Q96RJ3.pdb.gz	TR13C_HUMAN Tumor necrosis factor receptor superfamily member 13C OS=Homo sapiens OX=9606 GN=TNFRSF13C PE=1 SV=1
7	AFDB:Q0V865	0.129	0.076	1.581	463	0.176	0.084	Q0V865.pdb.gz	FAFL_ARATH Protein FAF-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g22090 PE=2 SV=1
8	PDB:2ndjA	0.112	0.216	2.104	103	0.077	0.165	2ndjA.pdb.gz
9	AFDB:P14317	0.111	0.055	2.436	486	0.158	0.072	P14317.pdb.gz	HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=3
10	AFDB:P43573	0.144	0.057	2.618	796	0.149	0.041	P43573.pdb.gz	BUD27_YEAST Bud site selection protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD27 PE=1 SV=1
11	AFDB:A0A024RCN4	0.086	0.045	3.024	479	0.140	0.065	A0A024RCN4.pdb.gz	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1
12	PDB:7w5a2	0.168	0.264	4.026	123	0.086	0.154	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:6ff4C	0.147	0.118	5.772	286	0.127	0.098	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:7wtwt	0.118	0.231	9.560	108	0.077	0.157	7wtwt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWG9	1.58e-162	449	221	1.000	1.000	KCNE4_HUMAN Potassium voltage-gated channel subfamily E member 4 OS=Homo sapiens OX=9606 GN=KCNE4 PE=1 SV=4
2	Q71FD8	8.83e-96	278	170	0.697	0.906	Q71FD8_RAT Potassium voltage-gated channel subfamily E regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Kcne4 PE=3 SV=1
3	Q6FHJ6	1.00e-04	43.1	129	0.100	0.171	Q6FHJ6_HUMAN Potassium voltage-gated channel subfamily E member 1 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
4	P15383	1.80e-04	42.4	130	0.104	0.177	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
5	P23299	3.72e-04	41.2	129	0.104	0.178	KCNE1_MOUSE Potassium voltage-gated channel subfamily E member 1 OS=Mus musculus OX=10090 GN=Kcne1 PE=1 SV=1
6	P15382	4.94e-04	41.2	129	0.086	0.147	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
7	Q9WTW2	0.003	38.1	103	0.090	0.194	KCNE3_MOUSE Potassium voltage-gated channel subfamily E member 3 OS=Mus musculus OX=10090 GN=Kcne3 PE=3 SV=1
8	Q2N1I1	0.004	38.1	99	0.090	0.202	Q2N1I1_HUMAN Cardiac voltage-gated potassium channel accessory subunit isoform 3a (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
9	Q6IAE6	0.005	37.7	103	0.090	0.194	Q6IAE6_HUMAN KCNE3 protein OS=Homo sapiens OX=9606 GN=KCNE3 PE=2 SV=1
10	Q9Y6H6	0.005	37.7	103	0.090	0.194	KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
11	Q9JJV7	0.017	36.2	107	0.077	0.159	KCNE3_RAT Potassium voltage-gated channel subfamily E member 3 OS=Rattus norvegicus OX=10116 GN=Kcne3 PE=1 SV=1
12	P63161	0.15	33.9	123	0.109	0.195	KCNE2_RAT Potassium voltage-gated channel subfamily E member 2 OS=Rattus norvegicus OX=10116 GN=Kcne2 PE=1 SV=1
13	Q9D808	0.17	33.5	123	0.131	0.236	KCNE2_MOUSE Potassium voltage-gated channel subfamily E member 2 OS=Mus musculus OX=10090 GN=Kcne2 PE=1 SV=2
14	Q9UJ90	0.27	33.5	142	0.050	0.077	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
15	P12537	0.99	32.7	585	0.109	0.041	CAP3_ADE05 Pre-hexon-linking protein IIIa OS=Human adenovirus C serotype 5 OX=28285 GN=L1 PE=1 SV=2
16	Q9Y6J6	2.0	30.4	123	0.100	0.179	KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens OX=9606 GN=KCNE2 PE=1 SV=1
17	D3Z7A5	3.7	30.8	415	0.100	0.053	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
18	D3YZQ8	4.6	30.4	356	0.100	0.062	D3YZQ8_MOUSE Dynein assembly factor with WDR repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=1 SV=1
19	A6H6T7	4.9	30.4	310	0.100	0.071	A6H6T7_MOUSE Dynein assembly factor with WDR repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=1 SV=1
20	Q9D3X2	4.9	30.4	310	0.100	0.071	Q9D3X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02060 ISK_Channel	5.1e-05	34.4	Slow voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281830

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.945	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000290310	0.931	Potassium voltage-gated channel subfamily E member 2
3	9606.ENSP00000310557	0.875	Potassium voltage-gated channel subfamily E member 3
4	9606.ENSP00000337255	0.863	Potassium voltage-gated channel subfamily E member 1
5	9606.ENSP00000358784	0.841	Potassium voltage-gated channel subfamily A member 3
6	9606.ENSP00000361173	0.822	Potassium voltage-gated channel subfamily E regulatory beta subunit 5
7	9606.ENSP00000262186	0.816	Potassium voltage-gated channel subfamily H member 2
8	9606.ENSP00000262916	0.774	Potassium voltage-gated channel subfamily KQT member 4
9	9606.ENSP00000358802	0.740	Potassium voltage-gated channel subfamily C member 4
10	9606.ENSP00000352035	0.713	Potassium voltage-gated channel subfamily KQT member 2
11	9606.ENSP00000356064	0.707	Tubby-related protein 4
12	9606.ENSP00000348573	0.705	A-kinase anchor protein 9
13	9606.ENSP00000333496	0.684	Potassium voltage-gated channel subfamily D member 2
14	9606.ENSP00000359264	0.676	Breast cancer anti-estrogen resistance protein 3
15	9606.ENSP00000420040	0.662	Kv channel-interacting protein 2
16	9606.ENSP00000282541	0.646	Glycerol-3-phosphate dehydrogenase 1-like protein
17	9606.ENSP00000248437	0.643	Tubulin alpha-4A chain
18	9606.ENSP00000229771	0.642	Tubby-related protein 1
19	9606.ENSP00000378132	0.642	Iroquois-class homeodomain protein IRX-5
20	9606.ENSP00000345055	0.632	Potassium voltage-gated channel subfamily KQT member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0098772	0.746	molecular function regulator activity
GO:0016247	0.736	channel regulator activity
GO:0099106	0.692	ion channel regulator activity
GO:0005215	0.489	transporter activity
GO:0022857	0.484	transmembrane transporter activity
GO:0015075	0.444	monoatomic ion transmembrane transporter activity
GO:0022890	0.436	inorganic cation transmembrane transporter activity
GO:0008324	0.429	monoatomic cation transmembrane transporter activity
GO:0015267	0.426	channel activity
GO:1901702	0.424	salt transmembrane transporter activity
GO:0046873	0.424	metal ion transmembrane transporter activity
GO:0015459	0.422	potassium channel regulator activity
GO:0005261	0.400	monoatomic cation channel activity
GO:0015079	0.395	potassium ion transmembrane transporter activity
GO:0005267	0.376	potassium channel activity
GO:0022839	0.357	monoatomic ion gated channel activity
GO:0005244	0.350	voltage-gated monoatomic ion channel activity
GO:0005249	0.328	voltage-gated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.963	regulation of cellular process
GO:0051179	0.962	localization
GO:0032501	0.824	multicellular organismal process
GO:0051234	0.775	establishment of localization
GO:0006810	0.755	transport
GO:0032879	0.621	regulation of localization
GO:0006811	0.568	monoatomic ion transport
GO:0051049	0.564	regulation of transport
GO:0050896	0.532	response to stimulus
GO:0006812	0.473	monoatomic cation transport
GO:0048518	0.458	positive regulation of biological process
GO:0010959	0.433	regulation of metal ion transport
GO:0065008	0.430	regulation of biological quality
GO:0034762	0.422	regulation of transmembrane transport
GO:0003008	0.393	system process
GO:0034765	0.393	regulation of monoatomic ion transmembrane transport
GO:0098662	0.391	inorganic cation transmembrane transport
GO:0034220	0.383	monoatomic ion transmembrane transport
GO:0098655	0.360	monoatomic cation transmembrane transport
GO:0030001	0.357	metal ion transport
GO:1904062	0.351	regulation of monoatomic cation transmembrane transport
GO:0042391	0.340	regulation of membrane potential
GO:0006813	0.331	potassium ion transport
GO:0065009	0.317	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.940	protein-containing complex
GO:0034703	0.920	cation channel complex
GO:0098590	0.879	plasma membrane region
GO:0005622	0.672	intracellular anatomical structure
GO:0045177	0.609	apical part of cell
GO:0016324	0.589	apical plasma membrane
GO:0008076	0.519	voltage-gated potassium channel complex
GO:0043226	0.384	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.395	K(+)(in) = K(+)(out)

[back to server]